Conserved Protein Domain Family
TIGR00271

?
TIGR00271: TIGR00271 
uncharacterized hydrophobic domain
This domain is in a family of archaeal proteins that includes AF0785 of Archaeoglobus fulgidus and in several eubacterial proteins, including the much longer protein sll1151 from Synechocystis PCC6803.
Statistics
?
PSSM-Id: 129372
View PSSM: TIGR00271
Aligned: 6 rows
Threshold Bit Score: 169.487
Threshold Setting Gi: 416205
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
AAA53486       1 STLSVTYLSFMTLATTLAACGVVLDNAVLIVGAMAIGPDFGPLAGVSVAMVERRHRLVARCLICLLVgfavAIAVTVLFS 80  Streptomyces albus
CAA20393     112 STLSITYVAFITLATMIAACGVVLDNAVLIVGAMAVGPEFGPLAGICTAIVQRAPRLALRSATALLVgfavAMAVTVGFS 191 Streptomyces co...
Q58091       105 ANLSKENMLMLILSTIVAIAGIYKDDVALLIASMIIAPLLGPNIALSLSITVADYKLALKSIKTLIA----ELIFVIILS 180 Methanocaldococ...
Q58618       113 VKITKNVIIKVILASIMGVIGLIEHNIPTLIGAMIIAPLVDTVMGSAIGTVLGDKELFIQGMKKELL----CSGIVIVCA 188 Methanocaldococ...
WP_010872472  46 SLRDISYWIEVLFAAGIATLGLVLNSPAVIIGAMLISPLMGPILANGMGLAAGDVVLWLRAAFNLLL----SCSLAIVFA 121 Synechocystis s...
WP_010878288 124 ASLNPGRSVVTAIAGVIALSGLIMNNAVIVIGAMLLAPLLGPIHGFAVNLSVGYVKLAFRSALNLLFdlflTMVFSTLFA 203 Archaeoglobus f...
AAA53486      81 LAMdaaGLFHAEQLTRhrPITEFIVSPDEFSLIVGVLAGVAGTLSLT---SAKSGALVGVAISVTTIPAAANAAVALSYG 157 Streptomyces albus
CAA20393     192 WIMtefGQFSEGKLEGerPNTGFVYAPDAFSFVVAVLAGIAGTLSLT---SAKSGALVGVAISVTTVPAAANAAVALSFG 268 Streptomyces co...
Q58091       181 MIA---GHYLPISLDN--PQIHSRITLDFWSIIIALSAGIAGSLSTV---SNISSIAVGVMIAIALLPPLAVFGLLIGAG 252 Methanocaldococ...
Q58618       189 FIP---SLFFVSKELV--LQYLSETSII-LSAIVAIIAGISGGMSIA---SGKEYEIIGVTIDVSILIPALLMGMALATM 259 Methanocaldococ...
WP_010872472 122 AIL---VVIVPFKEIT--PEILARTNPTLLDLIVALFSGAVGSVATCkqaKGVAASLPGVAIAVALMPPLCVVGYGIGIY 196 Synechocystis s...
WP_010878288 204 MMI---GLVHPLQLT---PEILLRTEVSPVYELLAVLLGFASILSLS---RGILESLAGVAVSASLLPPAVATGILLVIS 274 Archaeoglobus f...
AAA53486     158 NYAQTRASSE-------QLLLNLVAISVAGTLTL 184 Streptomyces albus
CAA20393     269 DTNQTVGSTE-------QLLLNLAGIVVAGTLTL 295 Streptomyces coelicolor A3(2)
Q58091       253 YVEQSFSALI-------LFLINMIAINLSAIVIF 279 Methanocaldococcus jannaschii DSM 2661
Q58618       260 DLYLIYITFI-------LLAINIVLLDVGGYIGL 286 Methanocaldococcus jannaschii DSM 2661
WP_010872472 197 FSLASSQGLTvakggglLFITNLVAIIFTAMIVF 230 Synechocystis sp. PCC 6803
WP_010878288 275 PPLAVKS-LT-------LTLQNVAGLMAGSLAGV 300 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap