Conserved Protein Domain Family
TIGR00270

?
TIGR00270: TIGR00270 
TIGR00270 family protein
[Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129371
View PSSM: TIGR00270
Aligned: 3 rows
Threshold Bit Score: 177.411
Threshold Setting Gi: 668356897
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58006         7 QMCELCG-KLTDKLYKVIIEGSEMNVCKECAKFGKspktysrlgkktIIGKGTITTNKQVKKPIKRRRD---IFDTLPML 82  Methanocaldococ...
WP_010876368   1 MRCEICGkKIVGKPLKTKIDSSVMEVCRECSKFGK------------IIREPTTPRKKSFRKPQKRSRR---PMDTVYEV 65  Methanothermoba...
AIG98968       1 MNCEICGrEIKGKGFKIVVEGSEVTVCGSCRQFGTe-------------KKPSVASQQGARRVVLKKKRgstKIEFTEEL 67  Archaeoglobus f...
Q58006        83 REDYGDVIREAREKRGLSIEELAKKLKMKASTLQKFERYELEPNEKEIKILEKELKISLTESIGEETSYYG-GRDEDGFT 161 Methanocaldococ...
WP_010876368  66 VEDYGRIIRTEREKRDWSREDLAERINEKVSVINRIESERMEPDIKLARKLERLLKIKLLEKFEADDLEKSeGGGFRGAT 145 Methanothermoba...
AIG98968      68 VENFHIIIRREREKRGWSQEQLAKKIQEKESLIKKIENAEITPEPEVVEKLEKLFNIKLREQVPEIKIEKS---KSLVPT 144 Archaeoglobus f...
Q58006       162 LGDFIKIKK 170 Methanocaldococcus jannaschii DSM 2661
WP_010876368 146 IGDIARIKR 154 Methanothermobacter thermautotrophicus
AIG98968     145 LGDvvvvkr 153 Archaeoglobus fulgidus DSM 8774
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap