Conserved Protein Domain Family
TIGR00269

?
TIGR00269: TIGR00269 
TIGR00269 family protein
[Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129370
View PSSM: TIGR00269
Aligned: 4 rows
Threshold Bit Score: 161.902
Threshold Setting Gi: 2501587
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58558       237 VKRIKPLKLIPEEEVKLYAEINNIKYQREPCPYSSLSYRHRMKKVIEILEEEKPGVKFSILRGYEK----LLKYLNVKEE 312 Methanocaldococ...
WP_010879092 197 VVRIKPFRYVYEKEVVVYGFLHELPMDFDECPYSHFPVRAAVRDFLYDFENKYPGRKFSVMSSFEKli-pCLKEIYPQID 275 Archaeoglobus f...
WP_010876810 176 VPRIKPLWSTPESEVRLWAVLNDVKVHLDSCPYSDLSMRSRIRDFLNHLESEKQGVKLRVMESLSR----TFLPLSETEG 251 Methanothermoba...
WP_010877348 163 IPKIKPLREIPEKEVALYVLARGLDVHLAGCPYASGSFRREIGDFLKQISVKRPTIMYSTLRGFDRikeiLRRDLSESGR 242 Methanothermoba...
Q58558       313 IRRCEICGFPCSGNICKVCSWLIKL 337 Methanocaldococcus jannaschii DSM 2661
WP_010879092 276 LNRCERCGEPTPRRICQACKLLEEL 300 Archaeoglobus fulgidus
WP_010876810 252 LRECLRCGEPSSGDKCKACEFLELI 276 Methanothermobacter thermautotrophicus
WP_010877348 243 SGICVKCGEPASGKLCKACTFIEEL 267 Methanothermobacter thermautotrophicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap