Conserved Protein Domain Family
trpB

?
TIGR00263: trpB 
tryptophan synthase, beta subunit
Tryptophan synthase catalyzes the last step in the biosynthesis of tryptophan. the beta chain contains the functional domain for or the synthesis of tryptophan from indole and serine. The enzyme requires pyridoxal-phosphate as a cofactor. The pyridoxal-P attachment site is contained within the conserved region [LIVM]-x-H-x-G-[STA]-H-K-x-N] [K is the pyridoxal-P attachment site] which is present between residues 90-100 of the model. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 272987
View PSSM: TIGR00263
Aligned: 10 rows
Threshold Bit Score: 644.801
Threshold Setting Gi: 499204641
Created: 7-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9X4E5        17 GRFG---IFGGRFVSETLMPLILDLEARYEHAKT--DPDFWAEMDDLWKNYVGRPSPLYFAPRLTEHLGgAKIYLKRDEL 91  Rhodobacter sph...
P26921         3 GKFG---KYGGIFVPELLIPALEELEAAFLHYSK--DRRFNEDLEHYLREYAGRPTGLYHARNLSEKLG-CRVYLKREDM 76  Methanothermoba...
O84172         1 -MFKhkhPFGGAFLPEELLAPIQNLKAEWEILKT--QQSFLSELDCILKNYAGRQTPLTEVKNFARAIDgPRVFLKREDL 77  Chlamydia trach...
P17167        15 GRYGk--DFGGQYIPETLMTELEKVTKAFNDLKD--NPEFKAELNDLLVNYANRPSLLYYAKNMTEDLGgAKIYLKREDL 90  Lactobacillus c...
WP_010966435   3 GRFG---KFGGQYVPETLMNAINELEVEFNKAIN--DEKFMMEYKYYLEKYVGRETPLYFAENMTKNLGgAKIYLKREDL 77  Clostridium ace...
WP_031905215  13 GFFG---EYGGQYVPETLMPAIIELKKAYKEAKA--DPEFQRELEYYLSEYVGRATPLTYAASYTESLGgAKIYLKREDL 87  Staphylococcus ...
WP_011712033   4 GYFG---AFGGAYIPEILHETFAQLTLAYETARA--DEAFWRHYIELMRNYSGRPTPLTFAENLSLAHGkRRIYIKREDL 78  Magnetococcus m...
WP_001096418   6 AYFG---EFGGQFVPQILVPALDQLEQAFIDAQQ--DDAFRAEFMSLLQEYAGRPTALTLTQNITKGTk-TKLYLKREDL 79  Vibrio cholerae
WP_002854204   4 AYYG---DFGGQFLPESAMFALNELEGAFLKFSK--DKLFKKELNELLKTYVGRPTPLYFARNLSKKYq-HEIYLKREDL 77  Campylobacter j...
WP_010902181  13 GTFG---DYGGQYVPEVLMPAVEELTDAYERYVLdnEDGFVDDFRQRIRSFGGRPTPLTHAPTLSQRHG-VDVYLKREDL 88  Halobacterium s...
Q9X4E5        92 NHTGAHKINNVLGQIILARRMGKTRIIAETGAGQHGVATATVCAKFGLKCVVYMGAHDVERQAPNVFRMRLLGAEVVPVT 171 Rhodobacter sph...
P26921        77 LHTGAHKINNTIGQALLAGYMGKRRLIAETGAGQHGIATAAAGALFGMDVDVYMGTEDVERQKLNVFRMEISGARVIPVD 156 Methanothermoba...
O84172        78 LHTGAHKLNNALGQCLLAKYLGKTRVVAETGAGQHGVATATACAYLGLDCVVYMGAKDVERQKPNVEKMRFLGAEVVSVT 157 Chlamydia trach...
P17167        91 NHTGAHKINNVIGQALLAKHLGKKRLIAETGAGQHGVATATIAALMGMDCEIFMGKEDTDRQKLNVYRMELLGAKVHPVT 170 Lactobacillus c...
WP_010966435  78 NHTGSHKLNNALGQVLLAKRMGKKRVIAETGAGQHGVATATAAALFGLECEVFMGAEDVERQALNVFRMKILGAKVNSVK 157 Clostridium ace...
WP_031905215  88 NHTGAHKINNALGQALLAKRMGKKKLVAETGAGQHGVASATVAALFDMELVVFMGSEDIKRQQLNVFRMELLGAKVVAVE 167 Staphylococcus ...
WP_011712033  79 NQTGAHKANNVMGQGLLVRRMGKTRVIAETGAGQHGVATATMAARLGLACTIYMGAKDVARQRPNVFWMEQLGATVIPVT 158 Magnetococcus m...
WP_001096418  80 LHGGAHKTNQVLGQALLAKRMGKHEIIAETGAGQHGVATALACALLGLKCRVYMGAKDVERQSPNVFRMRLMGATVIPVH 159 Vibrio cholerae
WP_002854204  78 NHTGAHKINNAIAQALLAKKMGKKKIIAETGAGQHGLATATAAALLGLECEIYMGATDVQRQALNVYKMELLGAKIHAVQ 157 Campylobacter j...
WP_010902181  89 LHGGAHKLNNALGQVLLAKYMGKDRIVAETGAGQHGTATAMACAALEMPCEIYMGRTDVNRQRPNVFRMRLHDADVNPVT 168 Halobacterium s...
Q9X4E5       172 SGRGTLKDAMNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQSIIGREVRWQLAEQEeGrLPDTLVAAIGGGSNAMG 251 Rhodobacter sph...
P26921       157 SGSRTLKDAINQAMRDWISSVEDTHYLIGSTMGPHPYPTMVKHFQSVIGREAREQILEIEgE-LPDTIIACVGGGSNAIG 235 Methanothermoba...
O84172       158 KGSCGLKDAVNQALQDWATTHSFTHYCLGSALGPLPYPDIVRFFQSVISAEVKEQIHAVA-GrDPDILIACIGGGSNAIG 236 Chlamydia trach...
P17167       171 SGSMVLKDAVNATLQEWASPSDDTFYVLGSAVGPAPFPEMVKHFQSVISTESKQQLQAKE-AqLPDMVVACVGGGSNAIG 249 Lactobacillus c...
WP_010966435 158 SGTNTLKDAINAAMRDWVTNIDNTYYVIGSVMGPHPYPTIVKDFQKIIGEEARKQILKAE-GrLPDYVVACVGGGSNSMG 236 Clostridium ace...
WP_031905215 168 DGQGTLSDAVNKALQYWVSHVDDTHYLLGSALGPDPFPTIVRDFQSVIGKEIKSQILKKE-GrLPDAIVACIGGGSNAIG 246 Staphylococcus ...
WP_011712033 159 SGSQTLKDAVNEAMRDWVGSMDNTHYVLGTACGAHPFPEMVSWFQSVIGQEARVQILEQE-GrLPDHVYACVGGGSNAMG 237 Magnetococcus m...
WP_001096418 160 SGSATLKDACNEALRDWSASYETAHYLLGTAAGPHPFPTIVREFQRIIGEETKNQILARE-GrLPDAVIACVGGGSNAIG 238 Vibrio cholerae
WP_002854204 158 SGLKTLKEATTAAIQAWVGDIKNIFYVVGSAVGPYPYPKMVMHFQSIIGKECKMQLQKLN-KkV-DYIIAAVGGGSNAAG 235 Campylobacter j...
WP_010902181 169 VGSGTLKEAINETMRDWATNVADTHYVIGSVVGPHPFPSMVRDFQAIISEELRAQSRE-QlGeLPAAVIACAGGGSNTMG 247 Halobacterium s...
Q9X4E5       252 LFHPFLD----------DPs----VRIVGVEAGGK--GVDDr---MEHCASLTGGR--PGVLHGNRTYLLQDADGQILEG 310 Rhodobacter sph...
P26921       236 IFSAFLD----------DD-----VELIGAEGGGE--GIES----GNHGATLSAGS--EGVLHGSLSYVLQDDDGQINEA 292 Methanothermoba...
O84172       237 FFHHFIP----------NPk----VQLIGVEGGGL--GISS----GKHAARFATGR--PGVFHGFYSYLLQDDDGQVLQT 294 Chlamydia trach...
P17167       250 SFAAYID----------DPs----VQLVGVEAAGK--GADT----DRTAATIERGS--VGIFHGMKSLFMQNEDGQIDPV 307 Lactobacillus c...
WP_010966435 237 IFYPFIK----------DEg----VKLIGVEAAGL--GIDT----PMHAATLTKGS--VGIIHGMMTYVLQDEDGQITPA 294 Clostridium ace...
WP_031905215 247 TFYPFIK----------DD-----VALYGVEAAGQ--GDDT----DKHALAIGKGS--PGVLHGTKMYLIQDEDGQVQLA 303 Staphylococcus ...
WP_011712033 238 IFQGFLE----------DPq----VELIGVEAGGL--GLAG----HNHASRIASGKstVGIAQGYKTCFLQDEDGQMRDT 297 Magnetococcus m...
WP_001096418 239 MFADFIE----------EEs----VRLIGIEPAGK--GIHT----HQHGAPLKHGK--TGIFFGMKAPLMQDEHGQVEES 296 Vibrio cholerae
WP_002854204 236 IFYDFIK----------DEn----VKLIGIEAGGL--GIDT----PYHAATLNKGK--TGIIHGMKTKVLQDDLGNILPV 293 Campylobacter j...
WP_010902181 248 AFGAFVGsaslpgapagTHepapdVDLLAVEAGGSrlGVDDdagyAPNSASLSTGT--EGVLHGARTKLLQTETGQIVES 325 Halobacterium s...
Q9X4E5       311 FSISAGLDYPGIGPEHAWLHDTGRAEYVSITDAEALEAFQLCCALEGIIPALEPSHALAHVIKIAPTLP-RDHIIVMNMC 389 Rhodobacter sph...
P26921       293 HSVSAGLDYPGVGPEHAYLMETGRAMYEPITDAEALRGFKLLSRCEGIMPALESAHAIACLEKYASKPEnRGKTVIVNLS 372 Methanothermoba...
O84172       295 HSISAGLDYPSVGPDHAEMHESGRAFYTLATDEEALRAFFLLTRNEGIIPALESSHALAHLVSIAPSLP-KEQIVIVNLS 373 Chlamydia trach...
P17167       308 YSISAGLDYPGVGPEHAALAQEGRAQYVGITDDEAVEAFTYIAKQEGIVAAIESCHAIAYVEKIAPQMA-KDQIIICTLS 386 Lactobacillus c...
WP_010966435 295 YSVSAGLDYPGVGPQHSYLKEKERASYEAVTDKEALKAFLYLSEKEGIIPALESSHAVAYAMKLAPSLS-KDEIVIINLS 373 Clostridium ace...
WP_031905215 304 HSISAGLDYPGIGPEHSYYHDIGRVTFENASDTQAMNALINFTKHEGIIPAIESAHALSYVERLAPTMS-KEDIIVVTIS 382 Staphylococcus ...
WP_011712033 298 HSVAAGLDYVGVSPILADLHQQGRVRFEAATDVEVVEALKRMVKSEGIIPALESSHAVAGALRELPQLK-EDAVVIINLS 376 Magnetococcus m...
WP_001096418 297 YSVSAGLDFPSVGPQHAYLNAIGRAEYESITDDEALDAFQALARNEGIIPALESSHALAHAIKMAYAEPdKEQLLVVNLS 376 Vibrio cholerae
WP_002854204 294 HSVSAGLDYPGIGPLHAFLFESKRAQYHAISDEECMQALKLLCKEEGIIAAIESSHALAFLEKLCPTLK-KKSVIVVNLS 372 Campylobacter j...
WP_010902181 326 HSVSAGLDYAGVGPELAHLVDTGRITPTNVDDDAALAAFHRLSRDEGVIPALETSHAVAALDQYDG-----DGPVVVNVS 400 Halobacterium s...
Q9X4E5       390 GRGDKDIFTVAKHL 403 Rhodobacter sphaeroides 2.4.1
P26921       373 GRGDKDMFLAAGLL 386 Methanothermobacter marburgensis str. Marburg
O84172       374 GRGDKDLPQIIRRN 387 Chlamydia trachomatis D/UW-3/CX
P17167       387 GRGDKDVASIAKYK 400 Lactobacillus casei
WP_010966435 374 GRGDKDVNTVMKNM 387 Clostridium acetobutylicum
WP_031905215 383 GRGDKDMETIRQYM 396 Staphylococcus aureus
WP_011712033 377 GRGDKDIFTIAEAL 390 Magnetococcus marinus
WP_001096418 377 GRGDKDIFTVHKLL 390 Vibrio cholerae
WP_002854204 373 GRGDKDMQMIRDYK 386 Campylobacter jejuni
WP_010902181 401 GRGDKDLDTVIEAS 414 Halobacterium salinarum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap