1V7Y


Conserved Protein Domain Family
trpA

?
TIGR00262: trpA 
Click on image for an interactive view with Cn3D
tryptophan synthase, alpha subunit
Tryptophan synthase catalyzes the last step in the biosynthesis of tryptophan. The alpha chain is responsible for the aldol cleavage of indoleglycerol phosphate to indole and glyceraldehyde 3-phosphate. In bacteria and plants each domain is found on a separate subunit (alpha and beta chains), while in fungi the two domains are fused together on a single multifunctional protein. The signature pattern for trpA contains three conserved acidic residues. [LIVM]-E-[LIVM]-G-x(2)-[FYC]-[ST]-[DE]-[PA]-[LIVMY]-[AGLI]-[DE]-G and this is located between residues 43-58 of the model. The Sulfolobus solfataricus trpA is known to be quite divergent from other known trpA sequences. [Amino acid biosynthesis, Aromatic amino acid family]
Statistics
?
PSSM-Id: 161792
View PSSM: TIGR00262
Aligned: 9 rows
Threshold Bit Score: 367.826
Threshold Setting Gi: 3334388
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1V7Y_A         8 FAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAgADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLAL 87  Escherichia coli
P07601         2 FKLDLQPSEKLFIPFITAGDPVPEVSIELAKSLQKAgATALELGVAYSDPLADGPVIQRASKRALDQGMNIVKAIELGGE 81  Bacillus subtil...
O28673         1 ------MIDRSLIVFFTACYPTAEKTVEFMLTAAESgADVIELGVPFSDPVADGKTIQESYVRALRN-FRVERVFEIAKA 73  Archaeoglobus f...
P00928         8 FAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAgADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLAL 87  Escherichia coli
P43759         8 FATLNAKNEGAFVPFVTLCDPTFDRSFEIICTLVDNgADALELGFPFSDPLLDGPVIQAANNRALTAGHSSEDSLKLLEK 87  Haemophilus inf...
P56141         7 FETLKKHEKMAFIPFVTLGDPNYELSFEIIKTLIISgVSALELGLAFSDPVADGITIQASHLRALKHASMAKN-FQLLKK 85  Helicobacter py...
O27697        10 AEMFRRADGCAFVPFVVAGDPDMETSLEIIRTLVDAgADALEVGFPFSDPIADGTSVQGADLRALRAGMTTEKCFQLIER 89  Methanothermoba...
P77960         8 FNALRQRGECALIPFLTAGDPDLATTAEALRILDRAgADLIELGVPYSDPLADGPVIQAAATRALQKGVKLDDVLAIVRE 87  Synechocystis s...
WP_015791805   7 FEELKNKGEKAFVAFYVGGDPNLEISEKALEVICKY-ADIVEIGIPFSDPVADGITIQKADVRALSSGMNPLKAFELAKK 85  Methanocaldococ...
1V7Y_A        88 IRQKhPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADdDLLRQIA 167 Escherichia coli
P07601        82 MKKNgVNIPIILFTYYNPVLQLNKEYFFALLRENHIDGLLVPDLPLEESNSLQEECKSHEVTYISLVAPTSE-SRLKTII 160 Bacillus subtil...
O28673        74 FRAE-SDKPLVLMSYYNPIYRRGVESFVEKAYSSGIDAMLVVDLPYDEAGDFVEVCSRTGMKNVFLAAPNTPeDRLRAMD 152 Archaeoglobus f...
P00928        88 IRQKhPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADdDLLRQIA 167 Escherichia coli
P43759        88 VRSKyPEIPISLLLCANLIFAKGLDAFYQRCAEVGVDAVLVADIPLLAKGDYVQTAKKHGIQPVFICPPNADeKTIQGVA 167 Haemophilus inf...
P56141        86 IRDYnHNIPIGLLAYANLIFSYGVDGFYAQAKECGIDSVLIADMPLIEKELVIKSAQKHQIKQIFIASPNASsKDLEQVA 165 Helicobacter py...
O27697        90 VREF-TSIPIGLLVYYNLIYRMGVDEFYRRAAEAGVTGILAADLPPEEASDALRAAEKYDIDQIFIVAPTTGsERLKRIS 168 Methanothermoba...
P77960        88 VHQD-IAAPIILFTYYNPIFYQGVEVFLDKIKAAGVKGLVVPDLPLEESDRLLEATAERGLELILLVAPTSSpERQTAIA 166 Synechocystis s...
WP_015791805  86 LSEKfPNTPKVFLTYYNIIFKMGEEEFVKKCKESGVSGIIVPDLPIEEADSLYNYCKKYGVDLIFLVAPTTPdERLKRIL 165 Methanocaldococ...
1V7Y_A       168 SYGRGYTYLLSRAGVTGAENRAALP-LNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAgAAgAISGSAIVKIIEQHi- 245 Escherichia coli
P07601       161 EQAEGFVYCVSSLGVTGVRNEFNSS-VYPFIRTVKNLSTVPVAVGFGISNREQVIKMNEI-SDgVVVGSALVRKIEELkd 238 Bacillus subtil...
O28673       153 ELSA-FVYLVSTYGVTGERDRISPL-AFEALKRAKGICRKPVAVGFGVSKADHVRQLISAgADgVVVGSAFVRLINEKg- 229 Archaeoglobus f...
P00928       168 SYGRGYTYLLSRAGVTGAENRAALP-LNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAgAAgAISGSAIVKIIEQHi- 245 Escherichia coli
P43759       168 KNSEGYTYLVSRAGVTSAENQAHAAnLDTLVEKLKAHNAPPILQGFGIAQPEQVKEALSLgTAgAISGSATVKIIERNl- 246 Haemophilus inf...
P56141       166 THSQGYIYALARSGVTGASRILEND-SSAIIKTLKAFSPTPALLGFGISKKEHITNAKGMgADgVICGSALVKIIEENl- 243 Helicobacter py...
O27697       169 EVSSGFHYLVSVMGVTGARSRVEDA-TIELIKRVKAEGSLPVMVGFGVSRPEHVRMLRDAgADgVIVGSAIIDVISGNl- 246 Methanothermoba...
P77960       167 KKSQGFVYLVSVTGVTGVRTEVGSR-VEALLAGMRQVTDKPIGVGFGISQPEQAEQVKAWgADaVIVGSAMVKRLAEG-- 243 Synechocystis s...
WP_015791805 166 EKCSGFVYVVSVTGTTGAREKIAEE-TKELVRRVKKYSKIPACVGFGISKKEHVEEITEI-ADgAIVGSAIVKIVEKHld 243 Methanocaldococ...
1V7Y_A       246 -----nEPEKMLAALKVFVQPMK 263 Escherichia coli
P07601       239 rlisaeTRNQALQEFEDYAMAFS 261 Bacillus subtilis subsp. subtilis str. 168
O28673       230 --------ERATEDIRALTENLR 244 Archaeoglobus fulgidus DSM 4304
P00928       246 -----nEPEKMLAALKVFVQPMK 263 Escherichia coli
P43759       247 -----dNHEQCLAELAEFVQTMK 264 Haemophilus influenzae Rd KW20
P56141       244 -----nNENAMLEKIKGFIGGMI 261 Helicobacter pylori 26695
O27697       247 -----gDRELMLQRIHEMAGTLK 264 Methanothermobacter thermautotrophicus str. Delta H
P77960       244 ------TPTEGLQALETFCRELK 260 Synechocystis sp. PCC 6803 substr. Kazusa
WP_015791805 244 engqikDEEKFLKDLEEFVKNLK 266 Methanocaldococcus fervens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap