Conserved Protein Domain Family
traB

?
TIGR00261: traB 
pheromone shutdown-related protein TraB
traB is a plasmid encoded gene that functions in the shutdown of the peptide sex pheromone cPD1 which is produced by the plasmid free recipient cell prior to conjugative transfer in Enterococcus faecalis. Once the recipient acquires the plasmid, production of cPD1 is shut down. The gene product may play another role in the other species in the family. [Unknown function, General]
Statistics
?
PSSM-Id: 129363
View PSSM: TIGR00261
Aligned: 3 rows
Threshold Bit Score: 502.074
Threshold Setting Gi: 499173295
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010870882  14 VNECDIYLIGTAHVSKDSIEEVEKIISSVSPEGIAVELDDRRFFSLITN----EEKKVDLKKVLKEGNFLKFFIYLILAN 89  Methanocaldococ...
WP_010877838   1 MEEKRLVIVGTAHVSKRSVEEVAEVIEREKPDAVAVELCPRRYHALVHG----QREEISVADVIRKGNVFMLLFQLILAY 76  Archaeoglobus f...
WP_002656981  22 IHNKTIYILGTAHVSKKSSEDTANLIEILKPDYIAVELDEARYHSILNTneneKWRNLDIDKALKQGKAFFLIINIILSN 101 Lyme disease sp...
WP_010870882  90 SQKKIGESFGIKPGSEMKKAIEIASKYGLPIYLIDRDIDITLSRLMDRMTFKEKMKIFWELLNSDEedLE-LDD--DLLN 166 Methanocaldococ...
WP_010877838  77 FQRKVGEETGVKPGSEMLAAIEKAREAGADVLLIDRDIGLTFTRFWQKLTFVEKIKLIFHLVRSTFsgDE-IEVdeMLEE 155 Archaeoglobus f...
WP_002656981 102 FQKKLAKEQGIKPGEEMKTAILKAKKHNIPLILADRKIETTLKRAWISIPIFEKAKIISSLFSLTDakITkDEIekLKEQ 181 Lyme disease sp...
WP_010870882 167 DMVknpEKFIKLLKEISPTIYEVLVDERDRFMAKRLFELSKNKNSLVAVVGAGHVEGIVRYLKKL-ENgNDIDLMELIKV 245 Methanocaldococ...
WP_010877838 156 DVL---DMLVKEFRKISPNAAKVLIDERDVYMAANLLNALSRYNRIVAVVGAGHRKGIEEALLKL-KE-NPVNLRELEEV 230 Archaeoglobus f...
WP_002656981 182 DAL---SKIMEELSKEIPKVKKVLIDERDEFITNKILEGEG---IILAIVGAGHVSGIMRTLKEIsQNkKIINVEELEKI 255 Lyme disease sp...
WP_010870882 246 KKRKkSLKKLLTYGISLTIISIFLyMICYALNnPELLKMITFQWILFTGGLSALGVLLARGKLITALVAFLSAPITTLVp 325 Methanocaldococ...
WP_010877838 231 KKGR-SYFKIFMGAFTALIVGTFI-LIATSLN-TEVLVQAFLYWFLINGVLSAVGASLARGHPLSIVTAFLCAWMTSLN- 306 Archaeoglobus f...
WP_002656981 256 PKKHfSFSKVLSYLIAISIILLIV--SSFYFKgFDFAYKNLKLWIISNSIFSGIASILLKSHPLTILTAIIGSPIFSLI- 332 Lyme disease sp...
WP_010870882 326 lPLAAVGTIAGLVELKYREITDKDLVGIINAES-IKELLNNNLFRVLLVATLSNLGASIGVFYCLGKFIGFLG 397 Methanocaldococcus jan...
WP_010877838 307 -PLVAAGWVSGLVEAWIRKPTVEDFSKLVEAES-LREMMQNKFFRVLLVAALTNVGSMIGTIYGGWYIISTFG 377 Archaeoglobus fulgidus
WP_002656981 333 -PFIGTGMVAGLVEAYINKPKVKDFENLQEELStIKGYFKNKVTRILLIVIFVNLGSTIGTIVGLKFLLNVFK 404 Lyme disease spirochete
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap