Conserved Protein Domain Family
thylakoid_BtpA

?
TIGR00259: thylakoid_BtpA 
membrane complex biogenesis protein, BtpA family
Members of this family are found in C. elegans, Synechocystis sp., E. coli, and several of the Archaea. Members in Cyanobacteria have been shown to play a role in protein complex biogenesis, and designated BtpA (biogenesis of thylakoid protein). Homologs in non-photosynthetic species, where thylakoid intracytoplasmic membranes are lacking, are likely to act elsewhere in membrane protein biogenesis. [Protein fate, Protein folding and stabilization]
Statistics
?
PSSM-Id: 129361
View PSSM: TIGR00259
Aligned: 4 rows
Threshold Bit Score: 352.961
Threshold Setting Gi: 3915360
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P72966  10 HNPVIGVVHLLPLPTSARWGGN--LTAVIERAEQEATALAAGGVDGIIVENFFDAPFPKqRVDPAVVSAMTLIVDRLQNL 87  Synechocystis sp. PCC...
P39364  11 EKAVIAMCHLRALPGDPSFDAQlgMNWVIDKAWDDLMALQNGGVDAVMFSNEFSLPYLT-KVRPETTAAMARIIGQLMSD 89  Escherichia coli K-12
O29828   2 EKTVIGVVHLLPLPGSPEHTD---LSAVIDKAVKDARAIEEGGADALILENYGDKPFLK-EVGKETVAAMTVIACEVKRD 77  Archaeoglobus fulgidu...
Q58515   7 KKPLIGMVHLKPLPGSYHYNDN--FDDIVDFAIKEAKKLEEAGFDAVMIENFGDAPFKK-EADKITIASMAVIAKAIKEE 83  Methanocaldococcus ja...
P72966  88 VVAPVGINVLRnDAHSALAIASCVGAKFIRvNVLTGVMATDQGLIEGNAHELLRYRRELSS-DVAILADVLVKHARPLGT 166 Synechocystis sp. PCC...
P39364  90 IRIPFGVNVLW-DPVASFDLAMATGAKFIR-EIFTGAYASDFGVWDTNVGETIRHQHRIGAgEVKTLFNIVPEAAVYLGN 167 Escherichia coli K-12
O29828  78 VSIGLGINVLRnDAVAALAIAKAVNADFVRvNQLFFTSVSPEGILEGKAGEVMRYKKLVDC-RAMIFADIAVKHAVHF-- 154 Archaeoglobus fulgidu...
Q58515  84 VSLPLGINILRnDAIGAYSIAYVVKADFIRvNVLSGVAFTDQGIIEGKAYELAKLKKLLPS-KIKVFADVHVKHAYHF-- 160 Methanocaldococcus ja...
P72966 167 PNLTTAVTDTIERGLADGIILSGWATGSPPNLEDLELATNAAKGTPVFIGSGADEDNIGQLIQAANGVIVASSLKRHGNI 246 Synechocystis sp. PCC...
P39364 168 RDICSIAKSTVFNNHPDALCVSGLTAGTRTDSALLKRVKETVPDTVVLANTGVCLENVEEQLSIADGCVTATTFKKDGVF 247 Escherichia coli K-12
O29828 155 ASLEDYCLN-AERSLADAVILTGKTTGGEVSLEELKYAKKTLK-MPVLAGSGVNAENAARILKWCDGVIVGTYIKRGG-- 230 Archaeoglobus fulgidu...
Q58515 161 IDFESSLLDTVERGLADAVIISGKRTGKEVDIEKLKLAKELVD-VPVIVGSGTNYNNLRILWSYADGFIIGTWIKKDGKA 239 Methanocaldococcus ja...
P72966 247 NEAIDPIRVSAFIEAMAEGLK 267 Synechocystis sp. PCC 6803 substr. Kazusa
P39364 248 ANFVDQARVSQFMEKVHHIRR 268 Escherichia coli K-12
O29828 231 --LVDAERVRRIVR-AAKG-- 246 Archaeoglobus fulgidus DSM 4304
Q58515 240 NNEIDIDRAKKIVN-LANKLK 259 Methanocaldococcus jannaschii DSM 2661
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap