1VI7


Conserved Protein Domain Family
IMPACT_YIGZ

?
TIGR00257: IMPACT_YIGZ 
Click on image for an interactive view with Cn3D
uncharacterized protein, YigZ family
This uncharacterized protein family includes YigZ, which has been crystallized, from E. coli. YigZ is homologous to the protein product of the mouse IMPACT gene. Crystallography shows a two-domain stucture, and the C-terminal domain is suggested to bind nucleic acids. The function is unknown. Note that the ortholog from E. coli was shown fused to the pepQ gene in GenBank entry X54687. This caused occasional misidentification of this protein as pepQ; this family is found in a number of species that lack pepQ. [Unknown function, General]
Statistics
?
PSSM-Id: 129359
View PSSM: TIGR00257
Aligned: 6 rows
Threshold Bit Score: 229.685
Threshold Setting Gi: 446776965
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1VI7_A         4 MESWLIPAAPVTVVEEIKKSRFITMLAHTDGVEAAKAFVESVRAEHPDARHHCVAWVAGAPDDSQQLGfsDDGEPAGTAG 83  Escherichia coli
P32437         2 LHSYFTVKEAGEHEIVIEKSRFICHLSRVSTEQEAQEFIQKIKKQHWNATHNCSAYVIGENDHIQKAN--DDGEPSGTAG 79  Bacillus subtil...
WP_001308167   1 MESWLIPAAPVTVVEEIKKSRFITMLAHTDGVEAAKAFVESVRAEHPDARHHCVAWVAGAPDDSQQLGfsDDGEPAGTAG 80  Enterobacteriaceae
WP_000854221   2 KTL----KNLITSKHQTKASRFLGYLMPF---DDFEKTLLQLKKEHFKAAHFVTAFRYSLEGKITE-GfsDDGEPKGSSG 73  Helicobacter py...
WP_010889749   1 M---FVPKNNSNSKIEIKKSIFVSYIFNIEKKDDINKTIKKYKIKFKNATHVVYGFRIGNKNSFLN-GmsDDREPNLTAG 76  Lyme disease sp...
P44842         1 MAEYLVPKSAVVFEEEIKKSRFITYLQHTEGLEDARAFWAKIKQEHPNARHHCWAAVAGKPTDSLQLGfsDDGEPAGTAG 80  Haemophilus inf...
1VI7_A        84 KPMLAQLMGSGVGEITAVVVRYYGGILLGTGGLVKAYGGGVNQALRQLTTQRKT----PLTEYTLQCEYHQLTGIEALLG 159 Escherichia coli
P32437        80 VPMLEVLKKRRLKDTCAVVTRYFGGIKLGAGGLIRAYGKSVSEGLNHIGVVERK----LMRIMHTSADYTWLGKIENELR 155 Bacillus subtil...
WP_001308167  81 KPMLAQLMGSGVGEITAVVVRYYGGILLGTGGLVKAYGGGVNQALRQLTTQRKT----PLTEYTLQCEYHQLTGIEALLG 156 Enterobacteriaceae
WP_000854221  74 MPMLSVLRREDLINIGLVSVRYFGGTLLGVGGLMKAYAKSALLCVENAQKEDALkdfvELETLSAHYSYKELDALQREIK 153 Helicobacter py...
WP_010889749  77 KPTLDAIIHNNLTDTLIITLRYFGGTLLGRGGLIKAYYKSAKEVINNTSIMEKE----ELEILSLNLTYNQYNSLLKMKN 152 Lyme disease sp...
P44842        81 KPMLSALQGSQLGEISAVVVRYYGGILLGTGGLVRAYGNGVQQALKLIESEIKV----ERTLFKLDCDYGQLRLVQQLCE 156 Haemophilus inf...
1VI7_A       160 QCDGKIINSDYQAFVLLRVALPAAKVAEFSAKLADFSRGSLQLLAIEE 207 Escherichia coli
P32437       156 ESQFLLKEIHYSENVEFETYVEEKETNAFSEWMTELTNGKSDIKEGEL 203 Bacillus subtilis subsp. subtilis str. 168
WP_001308167 157 QCDGKIINSDYQAFVLLRVALPAAKVAEFSAKLADFSRGSLQLLAIEE 204 Enterobacteriaceae
WP_000854221 154 KFSLQLSKKNFSNQSVEVEISGTRENLQAFLQQNKIN----------- 190 Helicobacter pylori
WP_010889749 153 KLEIEIIDSNFSNKINTSIKFKTKNKQKISEFFIENGLIQEILKFNKE 200 Lyme disease spirochete
P44842       157 KYQVEILSQGFQANIHLILGISEKTIEAFSSELTEKSSGRLVIQLLEI 204 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap