1JKE,1J7G


Conserved Protein Domain Family
TIGR00256

?
TIGR00256: TIGR00256 
Click on image for an interactive view with Cn3D
D-tyrosyl-tRNA(Tyr) deacylase
This homodimeric enzyme appears able to cleave any D-amino acid (and glycine, which does not have distinct D/L forms) from charged tRNA. The name reflects characterization with respect to D-Tyr on tRNA(Tyr) as established in the literature, but substrate specificity seems much broader. [Protein synthesis, tRNA aminoacylation]
Statistics
?
PSSM-Id: 129358
View PSSM: TIGR00256
Aligned: 6 rows
Threshold Bit Score: 228.196
Threshold Setting Gi: 20137627
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JKE_A   1 MIALIQRVTRASVTVEGEVTGEIGAGLLVLLGVEKDDDEQKANRLCERVLGYRIFSD-AEGKMNLNVQQAGGSVLVVSQF 79  Escherichia coli BW2952
P32147   1 MIALIQRVTRASVTVEGEVTGEIGAGLLVLLGVEKDDDEQKANRLCERVLGYRIFSD-AEGKMNLNVQQAGGSVLVVSQF 79  Escherichia coli
P44814   1 MIALIQRVSQAKVDVKGETIGKIGKGLLVLLGVEKEDNREKADKLAEKVLNYRIFSD-ENDKMNLNVQQAQGELLIVSQF 79  Haemophilus influenza...
O32042   1 krlvvqrvteasvtvdeevvgqigqglMVLVGITHDDTEDDAAYLADKVVNLRIFDD-SEGKMNLSLVDIGGEILSVSQF 79  Bacillus subtilis sub...
Q07648   1 MKIVLQKVSQASVVVDSKVISSIKHGYMLLVGISIDDSMAEIDKLSKKVLSLRIFEDeSRNLWKKNIKEANGEILSVSQF 80  Saccharomyces cerevis...
1J7G_A   1 MIALIQRVSQAKVDVKGETIGKIGKGLLVLLGVEKEDNREKADKLAEKVLNYRIFSD-ENDKMNLNVQQAQGELLIVSQF 79  Haemophilus influenza...
1JKE_A  80 TLAADTERGMRPSFSKGASPDRAEALYDYFVERCR-QQE-MNTQTGRFAADMQVSLVNDGPVTFWLQV 145 Escherichia coli BW2952
P32147  80 TLAADTERGMRPSFSKGASPDRAEALYDYFVERCR-QQE-MNTQTGRFAADMQVSLVNDGPVTFWLQV 145 Escherichia coli
P44814  80 TLAADTQKGLRPSFSKGASPALANELYEYFIQKCA-EK--LPVSTGQFAADMQVSLTNDGPVTFWLNV 144 Haemophilus influenzae Rd KW20
O32042  80 TLYGDTKKGRRPNYMNAAKPDKALGLYEKWNDLLR-EKG-IKVETGTFGAMMDVQLTNSGPVTLIMDS 145 Bacillus subtilis subsp. subtilis...
Q07648  81 TLMAKTKKGTKPDFHLAQKGHIAKELYEEFLKLLRsDLGeEKVKDGEFGAMMSCSLTNEGPVTIILDS 148 Saccharomyces cerevisiae S288c
1J7G_A  80 TLAADTQKGLRPSFSKGASPALANELYEYFIQKCA-EK--LPVSTGQFAADMQVSLTNDGPVTFWLNV 144 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap