Conserved Protein Domain Family
TIGR00255

?
TIGR00255: TIGR00255 
TIGR00255 family protein
The apparent ortholog from Aquifex aeolicus as reported is split into two consecutive reading frames. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129357
View PSSM: TIGR00255
Aligned: 4 rows
Threshold Bit Score: 388.816
Threshold Setting Gi: 401581
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P23839         1 MIRSMTAYARREIKGEWGSATWEMRSVNQRYLETYFRLPEQFRSLEPVVRERIRSRLTRGKVECTLRYEPDVSAQGELIL 80  Escherichia col...
P44726         1 MIYSMTAFARLEVKKDWGDAVWEIRSVNQRYLENFFRLPEQFRGLENTLREKLRQNLTRGKIECSLRIETKKQANAELNL 80  Haemophilus inf...
WP_009967215   1 MIRSMTGFGSASKTQDDLSVSVELKSVNYRFKEVNARLPRPLLYFEDKLKQTILQHIQRGRIELFVSVDSDMLVEKRLEI 80  Bacillales
WP_010889828   1 -MKSMTGFFYLEKIIGNYMFSVNLKSYNGKFLEFKFRLPEIFSGYDLDIRNLISKYISRG--NVFLNVGYKELVPSVNFT 77  Lyme disease sp...
P23839        81 NEKLAKQLVTAANWVKMQ-S--DEGEINPVDILRWPGVMAAQEQDL--DAIAAEILAALDGTLDDFIVARETEGQALKAL 155 Escherichia col...
P44726        81 NKELANQVIQSLQWIKAQ-A--GEGEINLTDVLRYPGVVEAQEQDL--DAISQDLLTAFDDLLTDFIAMRGREGEKLNDI 155 Haemophilus inf...
WP_009967215  81 DWPLLDEFVAAARDMKKRyQ--LSAEPDVMDFFKLDHVVQVHEEQTqnDKLEALIIDAAEEAVKGLCEMREKEGLLLAKD 158 Bacillales
WP_010889828  78 INPNYIEAISRLRDSLAHtNlnIKNELSLGDFLSLKGALIIDEDSEhqEEIYGLFKGVLEEALLHYNNGRSFEGENTKSD 157 Lyme disease sp...
P23839       156 IEQRLEGVTAEVVKVRSHMPEILQWQRERLVAKLED-AQVQLENNRLEQELVLLAQRIDVAEELDRLEAHVKETYNILKK 234 Escherichia col...
P44726       156 IQQRLDSIAVETDKVRSQMPAVLQWQRERLLQRFED-AQLNLDPQRVEQEMILLAQRIDVAEELDRLQMHVKETTNILKK 234 Haemophilus inf...
WP_009967215 159 CLMHIDQLEELVRETELLAADVVSRYRERLYARIKEwTEDVLDESRLVTECAIFADRSDITEEITRLKSHFAQFRDILAS 238 Bacillales
WP_010889828 158 IVSTLVLIERDLKIVKDACSDINVKLFASIKENISKlMDEFRDLN-IAEEAAKMAIRLDINEEIMRLDSHIETFYKNLEY 236 Lyme disease sp...
P23839       235 KEAVGRRLDFMMQEFNRESNTLASKSINAEVTNSAIELKVLIEQMREQIQNIE 287 Escherichia coli K-12
P44726       235 GGAVGRKLDFMMQELNRESNTLASKSINADITASAVELKVLIEQMREQIQNLE 287 Haemophilus influenzae Rd KW20
WP_009967215 239 GGAVGRKLDFLVQELNREANTIGSKANDHQITKLVVEMKSSIEKIKEQVQNIE 291 Bacillales
WP_010889828 237 -EICGKALEFISQEMHREITTMSNKAVDLDIKNLILNMKLNLEKIKEQIRNVE 288 Lyme disease spirochete
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap