1LN4


Conserved Protein Domain Family
RNA_bind_YhbY

?
TIGR00253: RNA_bind_YhbY 
Click on image for an interactive view with Cn3D
putative RNA-binding protein, YhbY family
A combination of crystal structure, molecular modeling, and bioinformatic data together suggest that members of this family, including YhbY of E. coli, are RNA binding proteins. [Unknown function, General]
Statistics
?
PSSM-Id: 129355
View PSSM: TIGR00253
Aligned: 4 rows
Threshold Bit Score: 113.839
Threshold Setting Gi: 2496099
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1LN4_A   3 LSTKQKQHLKGLAHPLKPVVLLGSNGLTEGVLAEIEQALEHHELIKVKIATED--RETKTLIVEAIVRETGACNVQVIGK 80  Escherichia coli
P42550   3 LSTKQKQHLKGLAHPLKPVVLLGSNGLTEGVLAEIEQALEHHELIKVKIATED--RETKTLIVEAIVRETGACNVQVIGK 80  Escherichia coli
Q58068  13 LTGKMKRMLRAKAHHLEPVVWVGKEG-SEKVIKEVDRQLKERGLIKVKVRKAAllYEDKYEIAEKLAKACDAEVVSVVGH 91  Methanocaldococcus ja...
P54454   2 LTGKQKRFLRSKAHHLTPIFQVGKGGVNDNMIKQIAEALEARELIKVSVLQNC--EEDKNDVAEALVKGSRSQLVQTIGN 79  Bacillus subtilis sub...
1LN4_A  81 TLVLYRP----------------TKERK-ISLP 96  Escherichia coli
P42550  81 TLVLYRP----------------TKERK-ISLP 96  Escherichia coli
Q58068  92 VITLFRPregwkkylakkpkkkvKKDEKiIELF 124 Methanocaldococcus jannaschii DSM 2661
P54454  80 TIVLYKE----------------SKENKqIELP 96  Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap