1JRM,1N91


Conserved Protein Domain Family
TIGR00251

?
TIGR00251: TIGR00251 
Click on image for an interactive view with Cn3D
TIGR00251 family protein
[Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129353
View PSSM: TIGR00251
Aligned: 6 rows
Threshold Bit Score: 98.3486
Threshold Setting Gi: 29839698
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1JRM_A         7 LREVGDDLLVNIEVSPASGKFGIPSYNEWRKRIEVKIHSPPQKGKANREIIKEFSETFGR---DVEIVSGQKSRQKTIRI 83  Methanothermoba...
O26734         7 LREVGDDLLVNIEVSPASGKFGIPSYNEWRKRIEVKIHSPPQKGKANREIIKEFSETFGR---DVEIVSGQKSRQKTIRI 83  Methanothermoba...
O28207         1 MREAKDGVLISVHVSPGS-KEVSFSYDEWRRAVEVRIKSPAKEGKANRELLGIFRQIFG----EVELVSGEKSRSKVLKG 75  Archaeoglobus f...
WP_001277223   4 VTVNDDGLVLRLYIQPKASRDSIVGLHG--DEVKVAITAPPVDGQANSHLVKFLGKQFRVaksQVVIEKGELGRHKQIKI 81  Escherichia coli
Q58035         6 IKESREGVLIDIDVQANAKKNEIVGINEWRKRLSIKIKAPATEGKANKEIIKFFKEIFKK---DVEIVSGKLNPQKTVLI 82  Methanocaldococ...
1N91_A         8 VTVNDDGLVLRLYIQPKASRDSIVGLHG--DEVKVAITAPPVDGQANSHLVKFLGKQFRVaksQVVIEKGELGRHKQIKI 85  Escherichia col...
1JRM_A        84 QGmGRDLFLKL 94  Methanothermobacter thermautotrophicus
O26734        84 QGmGRDLFLKL 94  Methanothermobacter thermautotrophicus str. Delta H
O28207        76 K---RE----- 78  Archaeoglobus fulgidus DSM 4304
WP_001277223  82 IN-PQQIPPEI 91  Escherichia coli
Q58035        83 GDiKKDEVIEI 93  Methanocaldococcus jannaschii DSM 2661
1N91_A        86 IN-PQQIPPEV 95  Escherichia coli O157:H7 str. EDL933
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap