Conserved Protein Domain Family

TIGR00250: RNAse_H_YqgF 
Click on image for an interactive view with Cn3D
putative transcription antitermination factor YqgF
This protein family, which exhibits an RNAse H fold in crystal structure, has been proposed as a putative Holliday junction resolvase, an alternate to RuvC. [Unknown function, General]
PSSM-Id: 129352
Aligned: 6 rows
Threshold Bit Score: 198.126
Threshold Setting Gi: 40889964
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
O34634  83 LETTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKKVIDKMAAVMILQGYLD 135 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap