1NMN,1VHX


Conserved Protein Domain Family
RNAse_H_YqgF

?
TIGR00250: RNAse_H_YqgF 
Click on image for an interactive view with Cn3D
putative transcription antitermination factor YqgF
This protein family, which exhibits an RNAse H fold in crystal structure, has been proposed as a putative Holliday junction resolvase, an alternate to RuvC. [Unknown function, General]
Statistics
?
PSSM-Id: 129352
View PSSM: TIGR00250
Aligned: 6 rows
Threshold Bit Score: 198.126
Threshold Setting Gi: 40889964
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NMN_A   6 LAFDFGTKSIGVAvGQRITG-TARPLPAIKAQDGTPDW--NIIERLLKEWQPDEIIVGLPLNMDGTEQPLTARARKFANR 82  Escherichia coli BW2952
P52050   6 LAFDFGTKSIGVAvGQRITG-TARPLPAIKAQDGTPDW--NIIERLLKEWQPDEIIVGLPLNMDGTEQPLTARARKFANR 82  Escherichia coli
P43981   6 LAFDFGTKSIGCAiGQSITG-TAQALPAFKAQDGIPNW--EAIEKCLKEWKPDVVIVGLPLNMDGTEQDLTLRARKFANR 82  Haemophilus influenza...
P74662   8 LGLDVGRKRIGVA-GCDGTGlIATGITTIVRSSYDQDI--AQIKQLVEERNVNLLVVGLPYTMAGEIGSQAKQVQKFARR 84  Synechocystis sp. PCC...
O34634   4 LGLDLGTKTLGVA-LSDEMGwTAQGIETIKINEAEGDYglSRLSELIKDYTIDKIVLGFPKNMNGTVGPRGEASQTFAKV 82  Bacillus subtilis sub...
1VHX_A   6 LGLDLGTKTLGVA-LSDEXGwTAQGIETIKINEAEGDYglSRLSELIKDYTIDKIVLGFPKNXNGTVGPRGEASQTFAKV 84  Bacillus subtilis
1NMN_A  83 IHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGKVDSASAVIILESYFE 135 Escherichia coli BW2952
P52050  83 IHGRFGVEVKLHDERLSTVEARSGLFEQGGYRALNKGKVDSASAVIILESYFE 135 Escherichia coli
P43981  83 LQGRFGVNVHLQDERLTTTQARSEIFERGGFKALKKGKIDGVSACLILESWFE 135 Haemophilus influenzae Rd KW20
P74662  85 VAEQLHLPLEYMDERLSSVEAENQLKARKRFSSYDKGLIDQQAAEIILQQWLD 137 Synechocystis sp. PCC 6803 substr. Kazusa
O34634  83 LETTYNVPVVLWDERLTTMAAEKMLIAADVSRQKRKKVIDKMAAVMILQGYLD 135 Bacillus subtilis subsp. subtilis str. 168
1VHX_A  85 LETTYNVPVVLWDERLTTXAAEKXLIAADVSRQKRKKVIDKXAAVXILQGYLD 137 Bacillus subtilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap