Conserved Protein Domain Family
TIGR00244

?
TIGR00244: TIGR00244 
transcriptional regulator NrdR
Members of this almost entirely bacterial family contain an ATP cone domain (pfam03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes. [Regulatory functions, DNA interactions]
Statistics
?
PSSM-Id: 129347
View PSSM: TIGR00244
Aligned: 4 rows
Threshold Bit Score: 245.117
Threshold Setting Gi: 18202564
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P25538   1 MHCPFCFAVDTKVIDSRLVGEGSSVRRRRQCLVCNERFTTFEVAELVMPRVVKSNDVREPFNEEKLRSGMLRALEKRPVS 80  Escherichia coli
P44946   1 MHCPFCDTEETKVIDSRLVSDGYQVRRRRECGHCHERFTTFEMAELIIPKIIKTDGTREPFNEDKLRSGIQHALEKRPVS 80  Haemophilus influenza...
Q45549   1 MKCPSCQHNGTRVLDSRPVDDGKSIRRRRECESCHYRFTTFEKVEETPLIVVKKEGVREEFSREKMLRGLIKACEKRPVS 80  Bacillus subtilis sub...
Q55622   1 MQCPHCQHHNSRVLESRSSEGGQSIRRRRECLECKHRFTTYERLELLPVTVIKQDGERQAFDRSKLLRGMVRACEKTDIN 80  Synechocystis sp. PCC...
P25538  81 SDDVEMAINHIKSQLRATGEREVPSKMIGNLVMEQLKKLDKVAYIRFASVYRSFEDIKEFGEEIARL 147 Escherichia coli
P44946  81 ADDVEKAINHIILQLRATGEREVPSKLVGKLAMNELKKLDKVAYIRFASVYLSFDDIDQFTIEIEKL 147 Haemophilus influenzae Rd KW20
Q45549  81 LKTLEDMCFDIEKELRNQGCSEVKSELVGEMVMDRLAKIDEVAYVRFASVYRQFKDINVFIDELKDL 147 Bacillus subtilis subsp. subtilis ...
Q55622  81 FQRLEHIVEEIEANLQQQPKREIHSEAIGQMVLQYLRQESEVAYIRFASVYGRFQGIADFVDTLEQL 147 Synechocystis sp. PCC 6803 substr....
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap