3R0I


Conserved Protein Domain Family
Dxr

?
TIGR00243: Dxr 
Click on image for an interactive view with Cn3D
1-deoxy-D-xylulose 5-phosphate reductoisomerase
1-deoxy-D-xylulose 5-phosphate is converted to 2-C-methyl-D-erythritol 4-phosphate in the presence of NADPH. It is involved in the synthesis of isopentenyl diphosphate (IPP), a basic building block in isoprenoid, thiamin, and pyridoxal biosynthesis. [Biosynthesis of cofactors, prosthetic groups, and carriers, Other]
Statistics
?
PSSM-Id: 161787
View PSSM: TIGR00243
Aligned: 6 rows
Threshold Bit Score: 545.571
Threshold Setting Gi: 2495695
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3R0I_A        13 MKQ-LTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEASAKLLKTMLQQ-QGSRTEV 90  Escherichia col...
Q55663         2 VKR-ISILGSTGSIGTQTLDIVTHHPDAFQVVGLAAGGNVALLAQQVAEFRPEIVAIRQAEKLEDLKAAVAElTDYQPMY 80  Synechocystis s...
P44055         2 QKQnIVILGSTGSIGKSTLSVIENNPQKYHAFALVGGKNVEAMFEQCIKFRPHFAALDDVNAAKILREKLIA-HHIPTEV 80  Haemophilus inf...
P56139         1 ----MVVLGSTGSIGKNALKIAKKFG--IEIEALSCGKNIALINEQIQVFKPKKVAILDPSDLNDLEPLG-------AEV 67  Helicobacter py...
WP_009967249   1 MKN-ICLLGATGSIGEQTLDVLRAHQDQFQLVSMSFGRNIDKAVPMIEVFQPKFVSVGDLDTYHKLKQMS---FSFECQI 76  Bacillus subtilis
P45568         1 MKQ-LTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEASAKLLKTMLQQ-QGSRTEV 78  Escherichia col...
3R0I_A        91 LSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQ 170 Escherichia col...
Q55663        81 VVGEEGVVEVARYGDAESVVTGIVGCAGLLPTMAAIAAGKDIALANKETLIAGAPVVLPLVEKMGVKLLPADSEHSAIFQ 160 Synechocystis s...
P44055        81 LAGRRAICELAAHPDADQIMASIVGAAGLLPTLSAVKAGKRVLLANKESLVTCGQLFIDAVKNYGSKLLPVDSEHNAIFQ 160 Haemophilus inf...
P56139        68 FVGLEGIDAMIEECTSNLVLNAIVGVAGLKASFKSLQRNKKLALANKESLVSAGHL-LDIS-----QITPIDSEHFGLWA 141 Helicobacter py...
WP_009967249  77 GLGEEGLIEAAVMEEVDIVVNALLGSVGLIPTLKAIEQKKTIALANKETLVTAGHIVKEHAKKYDVPLLPVDSEHSAIFQ 156 Bacillus subtilis
P45568        79 LSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQ 158 Escherichia col...
3R0I_A       171 SLpqpiQhnlgyaDLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWL 250 Escherichia col...
Q55663       161 CL----Q------GVPEGGLRRIILTASGGAFRDLPVERLPFVTVQDALKHPNWSMGQKITIDSATLMNKGLEVIEAHYL 230 Synechocystis s...
P44055       161 SLppeaQekigfcPLSELGVSKIILTGSGGPFRYTPLEQFTNITPEQAVAHPNWSMGKKISVDSATMMNKGLEYIEARWL 240 Haemophilus inf...
P56139       142 LL----Qn-------KTLKPKSLIISASGGAFRDTPLEFIPIQNAQNALKHPNWSMGSKITIDSASMVNKLFEILETYWL 210 Helicobacter py...
WP_009967249 157 AL----Q------GEQAKNIERLIITASGGSFRDKTREELESVTVEDALKHPNWSMGAKITIDSATMMNKGLEVIEAHWL 226 Bacillus subtilis
P45568       159 SLpqpiQhnlgyaDLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWL 238 Escherichia col...
3R0I_A       251 FNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNS-GVKPLDFCKLSALTFAAPDYDRYP- 328 Escherichia col...
Q55663       231 FGLDYDHIDIVIHPQSIIHSLIEVQDTSVLAQLGWPDMRLPLLYALSWPERIYT-DWEPLDLVKAGSLSFREPDHDKYP- 308 Synechocystis s...
P44055       241 FNASAEEMEVIIHPQSIIHSMVRYVDGSVITQMGNPDMRTPIAETMAYPHRTFA-GVEPLDFFKIKELTFIEPDFNRYP- 318 Haemophilus inf...
P56139       211 FGASLK-IDALIERSSIVHALVEFEDNSIIAHLASADMQLPISYAIDPKLASLSaSIKPLDLYALSAIKFEPISMERYTl 289 Helicobacter py...
WP_009967249 227 FDIPYEQIDVVLHKESIIHSMVEFHDKSVIAQLGTPDMRVPIQYALTYPDRLPLpDAKRLELWEIGSLHFEKADFDRFR- 305 Bacillus subtilis
P45568       239 FNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNS-GVKPLDFCKLSALTFAAPDYDRYP- 316 Escherichia col...
3R0I_A       329 -CLK-LAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLS--VLEKMDMREPQCVDDVLSVDANAREVARKE 404 Escherichia col...
Q55663       309 -CMQ-LAYGAGRAGGAMPAVLNAANEQAVALFLQEKISFLDIPRLIEKtcDLYVGQNTASPDLETILAADQWARRTVLEN 386 Synechocystis s...
P44055       319 -NLK-LAIDAFAAGQYATTAMNAANEIAVQAFLDRQIGFMDIAKINSK--TIERISPYTIQNIDDVLEIDAQAREIA-KT 393 Haemophilus inf...
P56139       290 wCYKdLLLENPKLG----VVLNASNEVAMEKFLNKEIAFGGLIQTISQalESYDKMPFKLSSLEEVLELDKEVRERF-KN 364 Helicobacter py...
WP_009967249 306 -CLQ-FAFESGKIGGTMPTVLNAANEVAVAAFLAGKIPFLAIEDCIEK--ALTRHQLLKKPSWRTFKKWTKIPGDTSIQY 381 Bacillus subtilis
P45568       317 -CLK-LAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLS--VLEKMDMREPQCVDDVLSVDANAREVARKE 392 Escherichia col...
3R0I_A       405 VMRLAS 410 Escherichia coli K-12
Q55663       387 SACVAT 392 Synechocystis sp. PCC 6803 substr. Kazusa
P44055       394 LLRE-- 397 Haemophilus influenzae Rd KW20
P56139       365 VAGV-- 368 Helicobacter pylori 26695
WP_009967249 382 SHKVVC 387 Bacillus subtilis
P45568       393 VMRLAS 398 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap