Conserved Protein Domain Family
CoA_E_activ

?
TIGR00241: CoA_E_activ 
CoA-substrate-specific enzyme activase, putative
This domain is found in a set of closely related proteins including the (R)-2-hydroxyglutaryl-CoA dehydratase activase of Acidaminococcus fermentans, in longer proteins from M. jannaschii and M. thermoautotrophicum that share an additional N-terminal domain, in a protein described as a subunit of the benzoyl-CoA reductase of Rhodopseudomonas palustris, and in two repeats of an uncharacterized protein of Aquifex aeolicus.This domain may be involved in generating or regenerating the active sites of enzymes related to (R)-2-hydroxyglutaryl-CoA dehydratase and benzoyl-CoA reductase.
Statistics
?
PSSM-Id: 129344
View PSSM: TIGR00241
Aligned: 5 rows
Threshold Bit Score: 347.55
Threshold Setting Gi: 2495734
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q60315         1 MILGIDVGSTTTKMVLMEDSKIIWYKIEDIGVVIEED---ILLKMVKEIEQ-KYPIDKIVATGYGRHKVS---FADKIVP 73  Methanocaldococ...
Q58210       149 ISLGIDSGSTTTKAVVMIDDEVAGTGWIYTKDVIESAk-eAVNNALKEAGIsLDQVETIGTTGYGRYTVGeyfKADLIQE 227 Methanocaldococ...
WP_020239058   3 YSIGIDSGSTATKGILLADG-VITRRFLVPTPFRPAT---AITEAWETLREgLETTPFLTLTGYGRQLVD---FADKQVT 75  Escherichia coli
WP_010879451   2 IAAGIDIGSLTAKCALMRDGKLIAYKVIKVSPNLEETaerVFQETLKAAGIgREEVERIVATGYGRNKVG---FADKKVT 78  Archaeoglobus f...
WP_010877471 146 LTLGIDSGSTTTKVVLMEDNEVIGTGWLPTTDVIGSAe-kGIEEALSGTGYkLEDIDGMGVTGYGRLTIGkhyGADLIQE 224 Methanothermoba...
Q60315        74 EVIALGKGANYFFNEADG---VIDIGGQDTKVLKIDkN-GKVVDFILSDKCAAGTGKFLEKALDILKIDKNEINKYKS-- 147 Methanocaldococ...
Q58210       228 ELTVNSKGAAYLADKQEGeatVIDIGGMDNKAISLY-D-AIPDGFTMGGICAGASGRFFEITARRLGVSLQELGELAAkg 305 Methanocaldococ...
WP_020239058  76 EISCHGLGARFLAPATRA---VIDIGGQDSKVIQLD-DdGNLCDFLMNDKCAAGTGRFLEVISRTLGTSVEQLDSITEn- 150 Escherichia coli
WP_010879451  79 EISCHARGAIYFIPTART---VVDIGGQDSKVIAIE-N-GKVAEFVMNDKCAAGTGRFLEVMAAALNLKVEELGDVAEr- 152 Archaeoglobus f...
WP_010877471 225 ELSVNSKGAVFLADHQKGeatVLDIGGMDNKVITVN-D-GIPDNFTMGGICAGASGRFLEITARRLGVEIDELGSLALkg 302 Methanothermoba...
Q60315       148 -DNIAKISSMCAVFAESEIISLLSKKVPKEGILMGVYESIINRVIP-MTNRLKIQ-NIVFSGGVAKNKVLVEMFEKKL-N 223 Methanocaldococ...
Q58210       306 dWRKIKMNSYCIVFGIQDLVTALAEGAKAEDVAAAAAHSVAEQVFEqQLQEVDVRdPVILVGGSSLLKGLVIAMEEVL-G 384 Methanocaldococ...
WP_020239058 151 -VTPHAITSMCTVFAESEAISLRSAGVAPEAILAGVINAMARRSAN-FIARLSCEaPILFTGGVSHCQKFARMLESHL-R 227 Escherichia coli
WP_010879451 153 aTKATKISSTCTVFAESEVISHLASGEKVEDIVAGIHEAIASRIAA-MARRVKIEpDIVLTGGVAKNKAMKKALEKEF-G 230 Archaeoglobus f...
WP_010877471 303 tYRKALLNSYCIVFGIQDLVTALAAGTSREDAAAAACHSVAEQVYEqQLQEIDVRePLIQVGGTSLIEGLVKAVSDILgG 382 Methanothermoba...
Q60315       224 KKLLIPKEPQIVCCVGAILV 243 Methanocaldococcus jannaschii DSM 2661
Q58210       385 RKIIVPRYSQLIGAVGAALL 404 Methanocaldococcus jannaschii DSM 2661
WP_020239058 228 MPVNTHPDAQFAGAIGAAVI 247 Escherichia coli
WP_010879451 231 MEVKTPPEPQIVGAVGAALL 250 Archaeoglobus fulgidus
WP_010877471 383 IDVIVPPYSQHIGAVGAALL 402 Methanothermobacter thermautotrophicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap