Conserved Protein Domain Family

TIGR00239: 2oxo_dh_E1 
Click on image for an interactive view with Cn3D
2-oxoglutarate dehydrogenase, E1 component
The 2-oxoglutarate dehydrogenase complex consists of this thiamine pyrophosphate-binding subunit (E1), dihydrolipoamide succinyltransferase (E2), and lipoamide dehydrogenase (E3). The E1 ortholog from Corynebacterium glutamicum is unusual in having an N-terminal extension that resembles the dihydrolipoamide succinyltransferase (E2) component of 2-oxoglutarate dehydrogenase. [Energy metabolism, TCA cycle]
PSSM-Id: 161785
Aligned: 5 rows
Threshold Bit Score: 1555.23
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
2JGD_B        900 RYAGRPASASPAVGYMSVHQKQQQDLVNDAL 930  Escherichia coli K-12
P07015        900 RYAGRPASASPAVGYMSVHQKQQQDLVNDAL 930  Escherichia coli
WP_005694388  918 KYAGRPASASPAVGYMSLHTKQQKQLVEDAL 948  Haemophilus influenzae
P20967        981 RYCGRNPSGAVAAGSKSLHLAEEDAFLKDVF 1011 Saccharomyces cerevisiae S288c
CAA38576      907 QYIGRRRRSSPAEGDPTEFIKKNRNVLYLIA 937  Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap