2JGD


Conserved Protein Domain Family
2oxo_dh_E1

?
TIGR00239: 2oxo_dh_E1 
Click on image for an interactive view with Cn3D
2-oxoglutarate dehydrogenase, E1 component
The 2-oxoglutarate dehydrogenase complex consists of this thiamine pyrophosphate-binding subunit (E1), dihydrolipoamide succinyltransferase (E2), and lipoamide dehydrogenase (E3). The E1 ortholog from Corynebacterium glutamicum is unusual in having an N-terminal extension that resembles the dihydrolipoamide succinyltransferase (E2) component of 2-oxoglutarate dehydrogenase. [Energy metabolism, TCA cycle]
Statistics
?
PSSM-Id: 161785
View PSSM: TIGR00239
Aligned: 5 rows
Threshold Bit Score: 1555.23
Threshold Setting Gi: 40003
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2JGD_B         14 YLSGANQSWIEQLYEDFLTDPDSVDANWRSTFQQLPGTg-VKPDQFHSQ-TREYFRRLAKDASRYSSTISDPDTNVKQVK 91   Escherichia c...
P07015         14 YLSGANQSWIEQLYEDFLTDPDSVDANWRSTFQQLPGTg-VKPDQFHSQ-TREYFRRLAKDASRYSSTISDPDTNVKQVK 91   Escherichia coli
WP_005694388   30 ALGGANQSYIEELYESYLSDPQSVEESWRKTFDSLPKT--TALEQPHTP-VRDYFRRLARENHNEAVTVIDPAAGAKLVK 106  Haemophilus i...
P20967         44 FLSTSNATYIDEMYQAWQKDPSSVHVSWDAYFKNMSNPkiPATKAFQAPpSISNFPQGTEAAPLGTAMTGSVDENVSIHL 123  Saccharomyces...
CAA38576       14 dfyGPNLGYALELYDQYTQDPYSIDPDLKEMFDELGAP--P-----------SDIKEASGTKEKGRVTADLIQKIASAVR 80   Bacillus subt...
2JGD_B         92 VLQLI-NAYRFRGHQHANLDPLG-----LWQQDKVADLDPSFHDLTEADFQETFNVGSFASGKE----TMKLG---ELLE 158  Escherichia c...
P07015         92 VLQLI-NAYRFRGHQHANLDPLG-----LWQQDKVADLDPSFHDLTEADFQETFNVGSFASGKE----TMKLG---ELLE 158  Escherichia coli
WP_005694388  107 VLQFI-NAYRFRGHLEANLDPLNy---yRWKVSFVPELDYRHHGFTEQDLNETFNINHYVYKRD----TIKLG---ELAQ 175  Haemophilus i...
P20967        124 KVQLLcRAYQVRGHLKAHIDPLGisfgsNKNNPVPPELTLDYYGFSKHDLDKEINLGPGILPRFardgKSKMSl-kEIVD 202  Saccharomyces...
CAA38576       81 LAEDI-RTY---GHLNASVNPLR------KDEKKSELFPLSDYGLTEEEIK---AIPASVICKDa---PKNISnglEAIQ 144  Bacillus subt...
2JGD_B        159 ALKQTYCGPIGAEYMHITSTEEKRWIQQRIESG--RATFNSEEKKR-FLSELTAAEGLERYLGAKFPGAKRFSLEGGDAL 235  Escherichia c...
P07015        159 ALKQTYCGPIGAEYMHITSTEEKRWIQQRIESG--RATFNSEEKKR-FLSELTAAEGLERYLGAKFPGAKRFSLEGGDAL 235  Escherichia coli
WP_005694388  176 MLKETYCGSIGLEFMHVQDMEQKMWLQSKMESLldKPLFTSEERVN-FLRELTAADGLERYLGAKFPGAKRFSLEGSDAF 254  Haemophilus i...
P20967        203 HLEKLYCSSYGVQYTHIPSKQKCDWLRERIEIPe-PYQYTVDQKRQ-ILDRLTWATSFESFLSTKFPNDKRFGLEGLESV 280  Saccharomyces...
CAA38576      145 YLRNTYKRTISFEFDHVHDFKEREWLTRKIESGe-LFQKNSAEKLSaVLERLTEVEGFEQFLHRTFVGQKRFSIEGLDAL 223  Bacillus subt...
2JGD_B        236 IPMLKEMIRHAGNSGTREVVLGMAHRGRLNVLVNVLGKKPQDLFDEFAGKHKEHL-----------GTGDVKYHMG-FSS 303  Escherichia c...
P07015        236 IPMLKEMIRHAGNSGTREVVLGMAHRGRLNVLVNVLGKKPQDLFDEFAGKHKEHL-----------GTGDVKYHMG-FSS 303  Escherichia coli
WP_005694388  255 IPLMKEIIRHSSRQGVNDVVMGMAHRGRLNMLVNVLGKKPENLFDEFAGKHSSER------------TGDVKYHQG-FSS 321  Haemophilus i...
P20967        281 VPGIKTLVDRSVELGVEDIVLGMAHRGRLNVLSNVVRKPNESIFSEFKGSSARDDi---------eGSGDVKYHLGmNYQ 351  Saccharomyces...
CAA38576      224 VPVLDDIIAQSVKSGTTSVNIGMAHRGRLNVLAHVLGKPYEIIFSEFQHAPRSLVpsedplesatdGRGMSNTIWGrIGS 303  Bacillus subt...
2JGD_B        304 DFQTDGGLVHLALAFNPSHLEIVSPVVIGSVRARLDRLDE-----PSSNKVLPITIHGDAAVTGQGVVQETLNMSKARGY 378  Escherichia c...
P07015        304 DFQTDGGLVHLALAFNPSHLEIVSPVVIGSVRARLDRLDE-----PSSNKVLPITIHGDAAVTGQGVVQETLNMSKARGY 378  Escherichia coli
WP_005694388  322 DFAVDDKRVHLTLAFNPSHLEIVSPVVIGSVRSRQTRMND-----TEHSKVLAITVHGDSAVAGQGVVQETLNMSNTRGY 396  Haemophilus i...
P20967        352 RPTTSGKYVNLSLVANPSHLESQDPVVLGRTRALLHAKNDl----KEKTKALGVLLHGDAAFAGQGVVYETMGFLTLPEY 427  Saccharomyces...
CAA38576      304 FKTLKQNQPALPLANNPSHLEFINPIVEGSTRAAQETRTQsgypvQDETKSLAILIHGDAAFPGEGIVAETLNLSSLKGY 383  Bacillus subt...
2JGD_B        379 EVGGTVRIVINNQVGFTTsNPLDARSTPYCTDIGKMVQAPIFHVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRH 458  Escherichia c...
P07015        379 EVGGTVRIVINNQVGFTTsNPLDARSTPYCTDIGKMVQAPIFHVNADDPEAVAFVTRLALDFRNTFKRDVFIDLVCYRRH 458  Escherichia coli
WP_005694388  397 SVGGTIRIVINNQIGFTTsNPNDTRSTEYCTDIAKMIQAPIIHVNGDDPEAVAFAARMAVEYRNLFKRDIFIDLISYRRH 476  Haemophilus i...
P20967        428 STGGTIHVITNNQIGFTT-DPRFARSTPYPSDLAKAIDAPIFHVNANDVEAVTFIFNLAAEWRHKFHTDAIIDVVGWRKH 506  Saccharomyces...
CAA38576      384 QVGGAIHIIANNMIGFTT-ESAESRSTKYASDLAKGYEIPIVHVNADDPEACLSAVKFAVEYRKTFNKDFLIDLIGYRRY 462  Bacillus subt...
2JGD_B        459 GHNEADEPSATQPLMYQKIKKHPTPRKIYADKLEQEKVATLEDATE----MVNLYRDALDAGDCVVAEWRPMNMHSFTWS 534  Escherichia c...
P07015        459 GHNEADEPSATQPLMYQKIKKHPTPRKIYADKLEQEKVATLEDATE----MVNLYRDALDAGDCVVAEWRPMNMHSFTWS 534  Escherichia coli
WP_005694388  477 GHNEADEPLATQPMMYSIIKKHPTPRKVYADRLVSEGVMTEEQVTE----MANDYRDALDNGDRVVSEWREMDTAKMDWL 552  Haemophilus i...
P20967        507 GHNETDQPSFTQPLMYKKIAKQKSVIDVYTEKLISEGTFSKKDIDEhkkwVWNLFEDAFEKAKDYVPSQREWLTAAWEGF 586  Saccharomyces...
CAA38576      463 GHNEMDEPSTTQPMLYDAVRKHPTSNKFSLKKLVKEGVVTEEVVQN----IEKSVTKRIEVAIQKVPSKKE-HTACEI-- 535  Bacillus subt...
2JGD_B        535 ---PYLNHEWDEEYPNKVEMKRLQELAKRISTVPEAVEMQSRVAKIYADR-QAMAAGEKlFDWGGAENLAYATLVDEGIP 610  Escherichia c...
P07015        535 ---PYLNHEWDEEYPNKVEMKRLQELAKRISTVPEAVEMQSRVAKIYGDR-QAMAAGEKlFDWGGAENLAYATLVDEGIP 610  Escherichia coli
WP_005694388  553 ---QYLNYDWTAPYESKFSQERFLTLAKRVCEYPESLRAHPRVEKIYNDR-KAMYQGEKlLDWGMAETMAYATLLDEGVN 628  Haemophilus i...
P20967        587 kspKELATEILPHEPTNVPESTLKELGKVLSSWPEGFEVHKNLKRILKNRgKSIETGEG-IDWATGEALAFGTLVLDGQN 665  Saccharomyces...
CAA38576      536 ----ELPEPVSNGFPDVDTSIHFHVLRKLNGELITGESFMFSQAKAHFRKtAKAFDDDRkVEWSLAESLAFASILKDGTP 611  Bacillus subt...
2JGD_B        611 VRLSGEDSGRGTFFHRHAVIHNQSNGSTYTPLQHIHNGQGAFRVWDSVLSEEAVLAFEYGYATAEPRTLTIWEAQFGDFA 690  Escherichia c...
P07015        611 VRLSGEDSGRGTFFHRHAVIHNQSNGSTYTPLQHIHNGQGAFRVWDSVLSEEAVLAFEYGYATAEPRTLTIWEAQFGDFA 690  Escherichia coli
WP_005694388  629 VRLSGEDAGRGTFFHRHAVVHNQNDGTGYVPLTHLHANQGRFEVWDSVLSEESVLAFEYGYATTDPKTLTIWEAQFGDFA 708  Haemophilus i...
P20967        666 VRVSGEDVERGTFSQRHAVLHDQQSEAIYTPLSTLNNEKADFTIANSSLSEYGVMGFEYGYSLTSPDYLVMWEAQFGDFA 745  Saccharomyces...
CAA38576      612 IRLTGQDSERGTFAQRNLVLHDSETGKEFVPLHHLSDCSTSFAVHNSPLSEGSVLGFEYGYNVHSPETLVLWEAQYGDFA 691  Bacillus subt...
2JGD_B        691 NGAQVVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQ-----------------NMQVCVPST 753  Escherichia c...
P07015        691 NGAQVVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQ-----------------NMQVCVPST 753  Escherichia coli
WP_005694388  709 NGAQIVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQ-----------------NMQVCVPST 771  Haemophilus i...
P20967        746 NTAQVIIDQFIAGGEQKWKQRSGLVLSLPHGYDGQGPEHSSGRLERFLQLANEDpryfpseeklqrqhqdcNFQVVYPTT 825  Saccharomyces...
CAA38576      692 NAAQVYFDQFISAGRAKWGQKSGLVMLLPHGYEGQGPEHSSGRIERFLQLAAEN-----------------NWTVANLTS 754  Bacillus subt...
2JGD_B        754 PAQVYHMLRRQA---LRGMRRPLVVMSPKSLLRHPLAVSSLEELANGTFLPAIGEIDE----LDPKGVKRVVMCSGKVYY 826  Escherichia c...
P07015        754 PAQVYHMLRRQA---LRGMRRPLVVMSPKSLLRHPLAVSSLEELANGTFLPAIGEIDE----LDPKGVKRVVMCSGKVYY 826  Escherichia coli
WP_005694388  772 PAQVYHMLRRQS---LRKMRRPLIAISPKSLLRHPLAVSSLDELINGTFQTVIGEIDE----LDPKDVKRVVMCSGKVYY 844  Haemophilus i...
P20967        826 PANLFHILRRQQ---HRQFRKPLALFFSKQLLRHPLARSSLSEFTEGGFQWIIEDIEHgksiGTKEETKRLVLLSGQVYT 902  Saccharomyces...
CAA38576      755 AAQYFHILRRQAkmlLREEIRPLVIMTPKSLLRNPNTVSEVQELSESRFQPVY---EQsglsHDYEKVTRLVLSSGKVSI 831  Bacillus subt...
2JGD_B        827 DL--LEQRRKNNQHDVAIVRIEQLYPFPHKAMQEVLQQFAHVKDFVWCQEEPLNQGAWYCSQHHFREVIPFG-----ASL 899  Escherichia c...
P07015        827 DL--LEQRRKNNQHDVAIVRIEQLYPFPHKAMQEVLQQFAHVKDFVWCQEEPLNQGAWYCSQHHFREVIPFG-----ASL 899  Escherichia coli
WP_005694388  845 DL--LEQRRANNQKDVAIIRIEQLYPFPHEDVKKALEPYAHVTDYVWCQEEPLNQGAWYCSKHNFESAIPES-----VKL 917  Haemophilus i...
P20967        903 AL--HKRRESLGDKTTAFLKIEQLHPFPFAQLRDSLNSYPNLEEIVWCQEEPLNMGSWAYTEPRLHTTLKETdkykdFKV 980  Saccharomyces...
CAA38576      832 DIsvHFNKLEDGKEWLHIARIEQLYPFPAKGVKELFAKLPNLKEIVWVQEEPQNMGAWGYISPYLTEIAPEG-----VSV 906  Bacillus subt...
2JGD_B        900 RYAGRPASASPAVGYMSVHQKQQQDLVNDAL 930  Escherichia coli K-12
P07015        900 RYAGRPASASPAVGYMSVHQKQQQDLVNDAL 930  Escherichia coli
WP_005694388  918 KYAGRPASASPAVGYMSLHTKQQKQLVEDAL 948  Haemophilus influenzae
P20967        981 RYCGRNPSGAVAAGSKSLHLAEEDAFLKDVF 1011 Saccharomyces cerevisiae S288c
CAA38576      907 QYIGRRRRSSPAEGDPTEFIKKNRNVLYLIA 937  Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap