1HJR


Conserved Protein Domain Family
ruvC

?
TIGR00228: ruvC 
Click on image for an interactive view with Cn3D
crossover junction endodeoxyribonuclease RuvC
Endonuclease that resolves Holliday junction intermediates in genetic recombination. The active form of the protein is a dimer. Structure studies reveals that the catalytic center, comprised of four acidic residues, lies at the bottom of a cleft that fits a DNA duplex. The model hits a single Synechocystis PCC6803 protein at a score of 30, below the trusted cutoff, that appears orthologous and may act as authentic RuvC. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129331
View PSSM: TIGR00228
Aligned: 4 rows
Threshold Bit Score: 239.448
Threshold Setting Gi: 3914941
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1HJR_A         3 ILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQ 82  Escherichia coli
O25544         3 ILGIDPGSRKCGYAIISHASNKLSLITAGFINITTTRLQEQILDLIEALDCLLDRYEVNEVAIEDIFFGYNPKSVIKLAQ 82  Helicobacter py...
WP_000968010   5 ILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYAGVTEIITQFQPDYFAIEQVFMAKNADSALKLGQ 84  Escherichia
P44633         4 ILGIDPGSRVTGYGVIRQTGKHLEYLGSGAIRTQVEDLPTRLKRIYAGVTEIITQFQPNMFAIEQVFMAKNADSALKLGQ 83  Haemophilus inf...
1HJR_A        83 ARGvAIVAAVNQELPVF-EYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQ-ADAADALAIAITHCHVSQnaMQ 158 Escherichia coli
O25544        83 FRG-ALSLKILERIGNFsEYTPLQVKKALTGNGKAAKEQVAFMVKRLLNITSEIKpLDISDAIAVAITHAQRLK--LH 157 Helicobacter pylo...
WP_000968010  85 ARGvAIVAAVNQELPVF-EYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQ-ADAADALAIAITHCHVSQnaMQ 160 Escherichia
P44633        84 ARGtAIVAAVNNDLPVF-EYAARLVKQTVVGIGSADKVQVQEMVTRILKLSDKPQ-ADAADALAIAITHAHSIQhsLH 159 Haemophilus influ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap