2B3Z,2AZN,2O7P,4HA7


Conserved Protein Domain Family
ribD_Cterm

?
TIGR00227: ribD_Cterm 
Click on image for an interactive view with Cn3D
riboflavin-specific deaminase C-terminal domain
Eubacterial riboflavin-specific deaminases have a zinc-binding domain recognized by the dCMP_cyt_deam model toward the N-terminus and this domain toward the C-terminus. Yeast HTP reductase, a riboflavin-biosynthetic enzyme, and several archaeal proteins believed related to riboflavin biosynthesis consist only of this domain and lack the dCMP_cyt_deam domain.
Statistics
?
PSSM-Id: 129330
View PSSM: TIGR00227
Aligned: 12 rows
Threshold Bit Score: 274.647
Threshold Setting Gi: 465506
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2B3Z_A 156 GLPYVTLKAAASLDGKIATSTGdSKWITSEAARQDAQQYRKTHQSILVGVGTVKADNPSLTCRLPNVT------------ 223 Bacillus subtilis
Q58085   7 KKPYIISNVGMTLDGKLATINN-DSRISCEEDLIRVHKIRANVDGIMVGIGTVLKDDPRLTVHKIKSD------------ 73  Methanocaldococcus ja...
O26337   1 MRPYVILNAAMTLDGKIATATG-SSEISGEEDLRRVHELRRECDAIMVGINTVLADDPRLTVHRVDAAp----------g 69  Methanothermobacter t...
O28272   1 MRPYVFVNVAASLDGKISDESRkQLRISCEEDLRIVDRLRAESDAIMVGIGTVLADDPRLTVKSAELRekrqk---dgke 77  Archaeoglobus fulgidu...
P44326 150 GMPFVQLKLAMSLDGRTAMASGeSKWITGPDARSDVQKMRAKSSALLSTSTTVIADDPSLNVRWDEFPenlkteykkewl 229 Haemophilus influenza...
P17618 144 GLPYVTLKAAASLDGKIATSTGdSKWITSEAARQDAQQYRKTHQSILVGVGTVKADNPSLTCRLPNVT------------ 211 Bacillus subtilis sub...
Q55158 146 QRPFGIFKYAMTLDGKIATAQAhSSWVTSSSARHWVHQLRSQCQAVIIGGNTVRRDNPLLTNHGVGEV------------ 213 Synechocystis sp. PCC...
P33312  28 IVPFVTLTYAQSLDARVSRGPGvRTTISHPETKTMTHYLRHHHDGILVGSGTVLADNPGLNCKWGPDPa----------a 97  Saccharomyces cerevis...
P25539 145 GFPYIQLKLGASLDGRTAMASGeSQWITSPQARRDVQLLRAQSHAILTSSATVLADDPALTVRWSELDeqtqalypqqnl 224 Escherichia coli K-12
2AZN_A   2 KKPYIISNVGXTLDGKLATINNdS-RISCEEDLIRVHKIRANVDGIXVGIGTVLKDDPRLTVHKIKSD------------ 68  Methanocaldococcus ja...
2O7P_A 150 GFPYIQLKLGASLDGRTAXASGeSQWITSPQARRDVQLLRAQSHAILTSSATVLADDPALTVRWSELDeqtqalypqqnl 229 Escherichia coli K-12
4HA7_A  33 IVPFVTLTYAQSLDARVSRGPGvRTTISHPETKTMTHYLRHHHDGILVGSGTVLADNPGLNCKWGPDPa----------a 102 Saccharomyces cerevis...
2B3Z_A 224 KQPVRVILDT----VLSIPEDAKVICDQi--APTWIFTTARaDEEKkk---rLSAFGVNIFTLETE-RIQIPDVLKILAE 293 Bacillus subtilis
Q58085  74 RNPVRIVVDS----KLRVPLNARVLNKD---AKTIIATTEDtNEEKekkikiLEDMGVEVVKCGRG-KVDLKKLMDILYD 145 Methanocaldococcus ja...
O26337  70 DNPVRVVVDS----MARTPPHFRVLNDE---APTVIGVSESaPPERva---eLRKR-AEVVVAGTR-RVDLHLLLERLHG 137 Methanothermobacter t...
O28272  78 PNPLRVVVDS----RCRVPLTARILNDE---ARTLVAVSRIaPEEKvr---eVKKV-AEVAVFGEE-RVELSALLEFLHR 145 Archaeoglobus fulgidu...
P44326 230 RQPVRVILDS----QHRIQPTHKLFLTH---SPVWLVSSEPrDLTG------FPDFCEQIIFPKEN---LLKELMRELGK 293 Haemophilus influenza...
P17618 212 KQPVRVILDT----VLSIPEDAKVICDQi--APTWIFTTARaDEEKkk---rLSAFGVNIFTLETE-RIQIPDVLKILAE 281 Bacillus subtilis sub...
Q55158 214 -NPLRVVLSR----SLDLPIEAQLWDQDv--AKTLVITEKTcDRNTls---hLEKLEVETLVLEQL---TPLAVMEELYQ 280 Synechocystis sp. PCC...
P33312  98 NSPRPIIIDTkqkwRFDGSKMQELFIKRqgkPPIVVVTSEPiIKEQ------HVDYAICPINDTTK-LVDWKKLFEILKE 170 Saccharomyces cerevis...
P25539 225 RQPIRIVIDS----QNRVTPVHRIVQQP---GETWFARTQE-DSRE------WPETVRTLLIPEHKgHLDLVVLMMQLGK 290 Escherichia coli K-12
2AZN_A  69 RNPVRIVVDS----KLRVPLNARVLNKD---AKTIIATTEDtNEEKekkikiLEDXGVEVVKCGRG-KVDLKKLXDILYD 140 Methanocaldococcus ja...
2O7P_A 230 RQPIRIVIDS----QNRVTPVHRIVQQP---GETWFARTQ----EDsr---eWPETVRTLLIPEHKgHLDLVVLXXQLGK 295 Escherichia coli K-12
4HA7_A 103 NSPRPIIIDTkqkwRFDGSKMQELFIKRqgkPPIVVVTSEPiIKEQ------HVDYAICPINDTTK-LVDWKKLFEILKE 175 Saccharomyces cerevis...
2B3Z_A 294 E-GIMSVYVEGGS-A-VHGSFVKEGCFQEIIFYFAPKLIGgTHAPSLISGEGFQSMKDVPLLQFTDITQIGRDIKLTAKP 370 Bacillus subtilis
Q58085 146 K-GIKSILLEGGG-T-LNWGMFKEGLVDEVSVYIAPKIFGgKEAPTYVDGEGFKTVDECVKLELKNFYRLGEGIVLEFKV 222 Methanocaldococcus ja...
O26337 138 M-GIERLMLEGGS-T-LNYSMLTGGLVDEVRVCIAPMIVGgRDARTLVDGEGIDEMADAIRLELKRSYTLGEDLIVEYTV 214 Methanothermobacter t...
O28272 146 K-GVRRLMVEGGG-T-LISSLISQNLVDEIRIYYGPIFIGgRDSPTVCDGESF---LKKCRIE--KIERIGEGFAVTARF 217 Archaeoglobus fulgidu...
P44326 294 R-QINTLWVEAGA-N-LSGSLIDAKLVDELIIYIAPKLLG-DNARGLCQLPNLTKLADAPLWQLNELEQIGDDIKLTYTP 369 Haemophilus influenza...
P17618 282 E-GIMSVYVEGGS-A-VHGSFVKEGCFQEIIFYFAPKLIGgTHAPSLISGEGFQSMKDVPLLQFTDITQIGRDIKLTAKP 358 Bacillus subtilis sub...
Q55158 281 R-NCLQVLWECGG-I-LAAEAIAMGTVQKVHAFLAPKIIGgVAAPTPVGELGFQQMTQALNLTDLHCQAIGPDWLFTGYL 357 Synechocystis sp. PCC...
P33312 171 EfNIRSVMVEGGAnV-INQLLLRSDIVNSLIITIGSTFLG--SSGTEVSPP------QTVNLKDMSWWKGITDVVLCARL 241 Saccharomyces cerevis...
P25539 291 Q-QINSIWVEAGP-T-LAGALLQAGLVDELIVYIAPKLLG-SDARGLCTLPGLEKLADAPQFKFKEIRHVGPDVCLHLVG 366 Escherichia coli K-12
2AZN_A 141 K-GIKSILLEGGG-T-LNWGXFKEGLVDEVSVYIAPKIFGgKEAPTYVDGEGFKTVDECVKLELKNFYRLGEGIVLEFKV 217 Methanocaldococcus ja...
2O7P_A 296 Q-QINSIWVEAGP-T-LAGALLQAGLVDELIVYIAPKLLG-SDARGLCTLPGLEKLADAPQFKFKEIRHVGPDVCLHLVG 371 Escherichia coli K-12
4HA7_A 176 EfNIRSVMVEGGA-NvINQLLLRSDIVNSLIITIGSTFLG--SSGTEVSPP------QTVNLKDMSWWKGITDVVLCARL 246 Saccharomyces cerevis...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap