
Conserved Protein Domain Family

TIGR00223: panD 
Click on image for an interactive view with Cn3D
Members of this family are aspartate 1-decarboxylase, the enzyme that makes beta-alanine and C02 from aspartate. Beta-alanine is then used to make the vitamin pantothenate, from which coenzyme A is made. Aspartate 1-decarboxylase is synthesized as a proenzyme, then cleaved to an alpha (C-terminal) and beta (N-terminal) subunit with a pyruvoyl group. [Biosynthesis of cofactors, prosthetic groups, and carriers, Pantothenate and coenzyme A]
PSSM-Id: 129327
Aligned: 4 rows
Threshold Bit Score: 184.733
Threshold Setting Gi: 2498745
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
P52999  79 VQEGDKVIIISYKMMSDQEAASHEPKVAVLNDQNKIEQMLGNEPARTI 126 Bacillus subtilis subsp. subtilis str. 168
P56065  78 VAIGDVVIILAYASMNEDEINAHKPSIVLVDEKNEILEKG-------- 117 Helicobacter pylori 26695
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap