Conserved Protein Domain Family
lpxB

?
TIGR00215: lpxB 
lipid-A-disaccharide synthase
Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 129319
View PSSM: TIGR00215
Aligned: 4 rows
Threshold Bit Score: 537.17
Threshold Setting Gi: 3913997
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P45011         1 MNKTNP-TIalVAGEVSGDILGAGLIRQLKAHYPNARFIGIAGPRMLAEGCETLVDMEELSVMGLAEILKHLPRLLKIRK 79  Haemophilus inf...
Q57310         1 MRIFIStGE--VSGDLQGSLLVGALRQQAEEQNLELELVGLGGEKMAAAGLTLLANTAAIGSVGLTESLRFIIPTWQIQQ 78  Synechocystis s...
O25537         1 M----P-TIlvSALEASSNAHLEELRQNLPEDY---RFIGVF------EGKEVLYSPREFSIMGFRDVIGRLGFLLKAHK 66  Helicobacter py...
WP_000139654   1 MTEQRPlTIalVAGETSGDILGAGLIRALKEHVPNARFVGVAGPRMQAEGCEAWYEMEELAVMGIVEVLGRLRRLLHIRA 80  Enterobacteriaceae
P45011        80 NVIQTMLQEKPDVYIGIDAPDFNLDV--ELKLKANGIKTIHYVSPSVWAWR--QNRIHKIAKATHQVLAFLPFEKAFYDK 155 Haemophilus inf...
Q57310        79 RVKRYLKTNPIDLLVLIDYMGPNLTIanYLRKTYPNLPILYYIAPQAWVWSptKRETAQIMAVTDRLLAIFPGEAEFFQK 158 Synechocystis s...
O25537        67 EMVQLAKQADMVLLMDSSSFNIPLAK--KIKKQDPHKKIMYYILPQVWAWK--KWRAKSLEKYCDFLGAILPFEVGYYQK 142 Helicobacter py...
WP_000139654  81 DLTKRFGELKPDVFVGIDAPDFNITL--EGNLKKQGIKTIHYVSPSVWAWR--QKRVFKIGRATDLVLAFLPFEKAFYDK 156 Enterobacteriaceae
P45011       156 FNVPCRFIGHTMADAIPLK-PNRAEACQTLQIDPAQRYLAILVGSRGSEVEFLAEPFLKTALLLKEQFPDLQFLVPLVNE 234 Haemophilus inf...
Q57310       159 QGLDVTWVGHPLLDRITKEaPSRGSAREKLGIDHNETVITLLPASRIQELRYLLPSICGAAQQLQSQLPNVKLLLPVSLK 238 Synechocystis s...
O25537       143 KAQ---YVGHPLLDEIKHYkKDIK-----------GETLVFMPGSRKSEIAKMFPLFVKAAQMLEQNEGFKRRVLVVPSF 208 Helicobacter py...
WP_000139654 157 YNVPCRFIGHTMADAMPLD-PDKNAARDVLGIPHDAHCLALLPGSRGAEVEMLSADFLKTAQLLRQTYPDLEIVVPLVNA 235 Enterobacteriaceae
P45011       235 KRRIQFETIKAKItpNLDLHLIDGNARQ-AMIAADATLLASGTAALEAMLCKSPMVVGYRMKPLTYFLAKRLVKTD--YI 311 Haemophilus inf...
Q57310       239 DYQPQIEQTLKEF--NLTVQLLEGKETLtAIAAADLAITKSGTVNLEIALLNVPQVILYRVSPLTMAIARRIFKFNlpFV 316 Synechocystis s...
O25537       209 FKGLD---LKALYgeDIQLFEISYDAHK-SLFEAEFAFICSGTATLEAALIGTPFVLAYRAKTMDFLIARMLVNLH--YI 282 Helicobacter py...
WP_000139654 236 KRREQFERIKAEVapDLSVHLLDGMGRE-AMVASDAALLASGTAALECMLAKCPMVVGYRMKPFTFWLAKRLVKTD--YV 312 Enterobacteriaceae
P45011       312 SLPNLLANEMLVPEMIQEECTPELLAEKLSVYLSDDesavKNRHVLIQHFTDLHQKIQCNAD-KQAAQAVIDL 383 Haemophilus influenzae...
Q57310       317 SPTNIVLNRGIMPELLQEQATASNIAQAGLELLLNG----DRQAKIAQDYQELREALGEPGVcERAAQAVLEF 385 Synechocystis sp. PCC ...
O25537       283 GLANIFYNALNNETPGLGESQLHPELIQHFLSVEGLlkayKEMDRERYFKESLRLREYLKHGsARKIANEMAF 355 Helicobacter pylori 26695
WP_000139654 313 SLPNLLAGRELVKELLQEECEPQKLAAALLPLLANG----KTSHAMHDTFRELHQQIRCNAD-EQAAQAVLEL 380 Enterobacteriaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap