2GMW


Conserved Protein Domain Family
GmhB_yaeD

?
TIGR00213: GmhB_yaeD 
Click on image for an interactive view with Cn3D
D,D-heptose 1,7-bisphosphate phosphatase
This family of proteins formerly designated yaeD resembles the histidinol phosphatase domain of the bifunctional protein HisB. The member from E. coli has been characterized as D,D-heptose 1,7-bisphosphate phosphatase, GmhB, involved in inner core LPS assembly (). [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
Statistics
?
PSSM-Id: 129317
View PSSM: TIGR00213
Aligned: 4 rows
Threshold Bit Score: 298.761
Threshold Setting Gi: 447018131
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2GMW_A        25 VPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSL-ADRD 103 Escherichia col...
P46452         2 NKAIFLDRDGTLNIDYGYVHEIDNFKFIDGVIDALRELKKMGYMLVLVTNQSGIARGYFSEDQFLQLTEWMDWSL-AEQD 80  Haemophilus inf...
WP_001095387   4 NKALFLDRDGIINIDKGYVSQKEDFEFQKGIFELLKHAKSLGYKLLLITNQSGINRGYYTLKDFEQLTQYLQESLfKELG 83  Helicobacter py...
P31546         5 VPAIFLDRDGTINVDHGYVHEIDNFEFIDGVIDAMRELKKMGFALVVVTNQSGIARGKFTEAQFETLTEWMDWSL-ADRD 83  Escherichia coli
2GMW_A       104 VDLDGIYYCPHHPQGsVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITP 183 Escherichia col...
P46452        81 VDLDGIYYCPHHSEG-KGEYKEDCDCRKPKSGMLLQAIKELKIDPTQSIMVGDKVEDLKAGIGAKVKMNVLVRTGKPVTG 159 Haemophilus inf...
WP_001095387  84 FNLDGIYFCRHAPEE-------NCACRKPKPSLILQAAKEHQICLEQSFMIGDKESDMLAGLNAKVKNNLLLIQNPLKTP 156 Helicobacter py...
P31546        84 VDLDGIYYCPHHPQGsVEEFRQVCDCRKPHPGMLLSARDYLHIDMAASYMVGDKLEDMQAAVAANVGTKVLVRTGKPITP 163 Escherichia coli
2GMW_A       184 EAENAADWVLNSLADLPQ 201 Escherichia coli K-12
P46452       160 EGEGIADYVLDSIVDLPR 177 Haemophilus influenzae Rd KW20
WP_001095387 157 HS-WIQCKDFKEMIDLIK 173 Helicobacter pylori
P31546       164 EAENAADWVLNSLADLPQ 181 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap