Conserved Protein Domain Family
gltS

?
TIGR00210: gltS 
sodium--glutamate symport carrier (gltS)
[Transport and binding proteins, Amino acids, peptides and amines]
Statistics
?
PSSM-Id: 129314
View PSSM: TIGR00210
Aligned: 4 rows
Threshold Bit Score: 555.157
Threshold Setting Gi: 399761
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P45240         3 YTFSTYETLALASLVLLLGYFLVKRINVLKTFNIPEPVVGGFIVAIGLLIWHKIDGTSFNFDKNLQTTMMLVFFTSIGLS 82  Haemophilus inf...
P19933         2 FHLDTLATLVAATLTLLLGRKLVHSVSFLKKYTIPEPVAGGLLVALALLVLKKSMGWEVNFDMSLRDPLMLAFFATIGLN 81  Escherichia coli
WP_001155986   4 IKLDIYATLVCMVLVLLLGRYVISKVKFLRDYDIPEPVVGGVLVAFAIMLARQFYNFGLQFDSSLKDPLMLTFFITIGLS 83  Helicobacter py...
WP_010871932   4 IQFNIRQTIIVAILVLYIGKYLTKKIKFLQSFNIPDAVSGGVLASLFFGLIYGIFRTEVAFNFPIRDAFLIIFFTCIGLS 83  Synechocystis s...
P45240        83 ANFSRLIKGGKPLVVFLFIAALLIFGQNVIGIASSMALGIHPAYGLLAGSVTLTGGHGTGAAWADTFAHQ-FNLQGATEI 161 Haemophilus inf...
P19933        82 ANIASLRAGGRVVGIFLIVVVGLLVMQNAIGIGMASLLGLDPLMGLLAGSITLSGGHGTGAAWSKLFIER-YGFTNATEV 160 Escherichia coli
WP_001155986  84 ADFKSLQKGGKMLAVFLLAVAGFVVCQNAVGISTASLLGVNPLMGLLGGSIALVGGHGTSAAWANFFTQPpYNFSSSLEV 163 Helicobacter py...
WP_010871932  84 SKLKVLLQGGKPLLILLATAVSFLVIQNFVGVGMASLLGQALPVGLLSGSISLSGGHGTAIAWSPVFYDN-HGIRNASEI 162 Synechocystis s...
P45240       162 AIACATFGLVFGGIIGGPVARFLLnRQKQGENP--ENDEVDd-IQEAFEHPTYKRKITARSLIETIAMISVCLLIGQYLD 238 Haemophilus inf...
P19933       161 AMACATFGLVLGGLIGGPVARYLV-KHSTTPNG--IPDDQE--VPTAFEKPDVGRMITSLVLIETIALIAICLTVGKIVA 235 Escherichia coli
WP_001155986 164 GMACATFGLVSGGIIGGPVAKYLIsKYKLEPKDtkEKDTLEgvVSKGFETPKEQRLITESSFVETLALIAIALLVGTFLS 243 Helicobacter py...
WP_010871932 163 AIACATFGLVFGGIVGGPIAKFLIiRNKLEPDC----DTKD--LTIGIRRDQDNVQIDYNTMLHTILVIGVTIGLGYEIN 236 Synechocystis s...
P45240       239 VQTKGTALQLPTFVWCLFTGVIVRN--ILTNIFRFQVAES-AIDVLGSVGLSIFLAIALMSLRLWELAGLAIDVLIVLAI 315 Haemophilus inf...
P19933       236 QLLAGTAFELPTFVCVLFVGVILSN--GLSIMGFYRVFER-AVSVLGNVSLSLFLAMALMGLKLWELASLALPMLAILVV 312 Escherichia coli
WP_001155986 244 HLVPK-SFTLPTFVWCLFVGVILRN--TLSFFKIHSVFDR-EVSVIGNVSLSLFLAYALMSVNLLELLKLAVPLAVILSV 319 Helicobacter py...
WP_010871932 237 DLVAKLGLMLPAFVSCLLAGIVLTNtiPLAFKKFPWPAETpSLALISDVSLGLFLAISLMSLQLWTLADIGGVIALILLV 316 Synechocystis s...
P45240       316 QVAFMAAFAIFITYRAMGKDYDAVVLSAGHCGFGLGATPTAIANMQAVTSRFGPSHKAFLIVPMVGAFFIDLINAALLKV 395 Haemophilus inf...
P19933       313 QTIFMALYAIFVTWRMMGKNYDAAVLAAGHCGFGLGATPTAIANMQAITERFGPSHMAFLVVPMVGAFFIDIVNALVIKL 392 Escherichia coli
WP_001155986 320 QVVFMILYVVLVTFRVCGKDYDAAVLCAGHCGFGLGATPTAMVNMQTITNHYGPSHVAFIVVPLVGAFFVDIINALAIKG 399 Helicobacter py...
WP_010871932 317 QFMATVLYSIAVVFPLMGRDYNAAVVCSGYSGLTLGATPTAIANMTAVTEKFGAAPQAFIVVPLVGAFFIDIANAFVIQQ 396 Synechocystis s...
P45240       396 SFAVVN 401 Haemophilus influenzae Rd KW20
P19933       393 YLMLPI 398 Escherichia coli
WP_001155986 400 FLLLPF 405 Helicobacter pylori
WP_010871932 397 FLNFLG 402 Synechocystis sp. PCC 6803
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap