1HXQ


Conserved Protein Domain Family
galT_1

?
TIGR00209: galT_1 
Click on image for an interactive view with Cn3D
galactose-1-phosphate uridylyltransferase, family 1
This enzyme is involved in glucose and galactose interconversion. This model describes one of two extremely distantly related branches of the model pfam01087. [Energy metabolism, Sugars]
Statistics
?
PSSM-Id: 129313
View PSSM: TIGR00209
Aligned: 4 rows
Threshold Bit Score: 668.975
Threshold Setting Gi: 587574
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1HXQ_B     1 MTQFNPVDHPHRRYNPLTGQWILVSPHRAKRPWQGAQETPAKQVLPAHDPDCFLCAGNVRVTGDKNPDYTGTYVFTNDFA 80  Escherichia coli K-12
P09148     1 MTQFNPVDHPHRRYNPLTGQWILVSPHRAKRPWQGAQETPAKQVLPAHDPDCFLCAGNVRVTGDKNPDYTGTYVFTNDFA 80  Escherichia coli K-12
P31764     2 TALFEPTEHPHRRYNPLIDQWVLVSPHRAKRPWQGQQEKVNEEQKPSYDPTCYLCPSNKRITGELNPDYRKPYVFKNDFS 81  Haemophilus influen...
CAA57105   3 AEEFDFSSHSHRRYNPLTDSWILVSPHRAKRPWLGQQEAAYKPTAPLYDPKCYLCPGNKRATGNLNPRYESTYIFPNDYA 82  baker's yeast
1HXQ_B    81 ALMSDTPDAPESH-------DPLMRCQSARGTSRVICFSPDHSKTLPELSVAALTEIVKTWQEQTAELG-------KTYP 146 Escherichia coli K-12
P09148    81 ALMSDTPDAPESH-------DPLMRCQSARGTSRVICFSPDHSKTLPELSVAALTEIVKTWQEQTAELG-------KTYP 146 Escherichia coli K-12
P31764    82 ALLEDTPAPEKSS-------DPLFQSSQARGESRVICFSPDHSKTLPLLTALEIEEVIKVWQEQLRELG-------AKYQ 147 Haemophilus influen...
CAA57105  83 AVRLDQPILPQNDsnednlkNRLLKVQSVRGNCFVICFSPNHNLTIPQMKQSDLVHIVNSWQALTDDLSrearenhKPFK 162 baker's yeast
1HXQ_B   147 WVQVFENKGAAMGCSNPHPHGQIWANSFLPNEAEREDRLQKEYFAEQKSPMLVDYVQRELADGSRTVVETEHWLAVVPYW 226 Escherichia coli K-12
P09148   147 WVQVFENKGAAMGCSNPHPHGQIWANSFLPNEAEREDRLQKEYFAEQKSPMLVDYVQRELADGSRTVVETEHWLAVVPYW 226 Escherichia coli K-12
P31764   148 WVQIFENKGAAMGCSNPHPHGQIWANSFLPNEVAREDRTQRDYLLKHGSVMLVDYVKRELALKERIVVETEHWIALVPYW 227 Haemophilus influen...
CAA57105 163 YVQIFENKGTAMGCSNLHPHGQAWCLESIPSEVSQELKSFDKYKREHNTDLFADYVKLESREKSRVVVENESFIVVVPYW 242 baker's yeast
1HXQ_B   227 AAWPFETLLLPKAHVLRITDLTDAQRSDLALALKKLTSRYDNLFQCSFPYSMGWHGAPFN--GEENQHWQLHAHFYPPLL 304 Escherichia coli K-12
P09148   227 AAWPFETLLLPKAHVLRITDLTDAQRSDLALALKKLTSRYDNLFQCSFPYSMGWHGAPFN--GEENQHWQLHAHFYPPLL 304 Escherichia coli K-12
P31764   228 AIWPFETLLLPKTHVKRLTELSDEQSKDLAVILKKLTTKYDNLFETSFPYSMGFHAAPFN--GEDNEHWQLHAHFYPPLL 305 Haemophilus influen...
CAA57105 243 AIWPFETLVISKKKLASISQFNQMVKEDLASILKQLTIKYDNLFETSFPYSMGIHQAPLNatGDELSNSWFHMHFYPPLL 322 baker's yeast
1HXQ_B   305 RSATVRKFMVGYEMLAETQRDLTAEQAAERLRAVS-DIHFRESG 347 Escherichia coli K-12
P09148   305 RSATVRKFMVGYEMLAETQRDLTAEQAAERLRAVS-DIHFRESG 347 Escherichia coli K-12
P31764   306 RSATVRKFMVGYEMLGENQRDLTAEQAAERLRALS-EVHYKERT 348 Haemophilus influenzae Rd KW20
CAA57105 323 RSATVRKFLVGFELLGEPQRDLTSEQAAEKLRNLDgQIHYLQRL 366 baker's yeast
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap