Conserved Protein Domain Family
fliF

?
TIGR00206: fliF 
flagellar basal-body M-ring protein/flagellar hook-basal body protein (fliF)
Component of the M (cytoplasmic associated) ring, one of four rings (L,P,S,M) which make up the flagellar hook-basal body which is a major portion of the flagellar organelle. Although the basic structure of the flagella appears to be similar for all bacteria, additional rings and structures surrounding the basal body have been observed for some bacteria (eg Vibrio cholerae and Treponema pallidum). [Cellular processes, Chemotaxis and motility]
Statistics
?
PSSM-Id: 129310
View PSSM: TIGR00206
Aligned: 4 rows
Threshold Bit Score: 666.202
Threshold Setting Gi: 120324
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q44912         1 MSKFFTNFFvsAKGIFKKASTVQKIALGLIIFFVILALVFLIGFSTKSq-----SIALFGVEIKDQyLLDRISQRLDREN 75  Borrelia burgdo...
P25798         1 MNATAAQTK--SLEWLNRLRANPKIPLIVAGSAAVAVMVALILWAKAP------DYRTLFSNLSDQ-DGGAIVSQLTQMN 71  Escherichia col...
P23447         1 MNRTLMQMKnkTSEFWKNRSKLQKILMVSALAAIIIIGIIISVFASNS------KMAPLYKDLSAE-EAGQIKEELDAKK 73  Bacillus subtil...
WP_000364750   1 MDLKVLLQR--IVDFFIKLNKKQKIALIAAGVLITALLVFLLLYPFKEkdytqgGYGVLFEGLDSS-DNALILQHLQQNQ 77  Helicobacter py...
Q44912        76 VKYFLSSDGRIYLDDEKLAKKMRAILVREELVPVHMDPWALFDIDR-WTITDFERSINLRRSITRAVEQHIVALDDVDAV 154 Borrelia burgdo...
P25798        72 IPYRFSEASGAIEVPADKVHELRLRLAQQGLPKGGAVGFELLDQEK-FGISQFSEQVNYQRALEGELSRTIETIGPVKGA 150 Escherichia col...
P23447        74 VPNELSNGGTVISVPEDQVDSLKVQMAAEGLPKTGSIDYSFFGQNAgFGLTDNEFDMVKVKATQTELSNLINEMDGIKNS 153 Bacillus subtil...
WP_000364750  78 IPYKVSKDD-TILIPKDKVYEERITLASQGIPKTSKVGFEIFDTKD-FGATDFDQNIKLIRAIEGELSRTIESLNPILKA 155 Helicobacter py...
Q44912       155 SVNLVMPEKALFKES-QEPVKASVRITPRPGSDIITNRkkVEGLVKLIQYAIEGLESDNIAIVDNSGTILNDfSNLDgid 233 Borrelia burgdo...
P25798       151 RVHLAMPKPSLFVRE-QKSPSASVTVNLLPGRALDEGQ--ISAIVHLVSSAVAGLPPGNVTLVDQGGHLLTQ-SNTS--- 223 Escherichia col...
P23447       154 KVMINLPKDAVFVGEeQSAASASIVLQIQPGYTLDQSQ--INGLYHLVSKSVPNLKEDNIVIMDQNSTYYDK-SDSDags 230 Bacillus subtil...
WP_000364750 156 NVHIAIPKDSVFVAK-EVPPSASVMLKLKPDMKLSPTQ--ILGIKNLIAAAVPKLTIENVKIVNENGESIGE-GDILe-n 230 Helicobacter py...
Q44912       234 RIDLAEKERKLKLKYEAMLRGEIDSALSKVLSVDRfMIARVNVKLDTSKETTESKEYAPIELQsqdpkasyntrkvSDST 313 Borrelia burgdo...
P25798       224 GRDLNDAQLKYASDVEGRIQRRIEAILSPIVGNGN-IHAQVTAQLDFASKEQTEEQYRPNGDE-------------SHAA 289 Escherichia col...
P23447       231 YADSYSSQQGIKSQVEKDIQKHVQSLLGTMMGQDK-VVVSVTADIDFTKENRTEDIVEPVDKEn------------MEGI 297 Bacillus subtil...
WP_000364750 231 SKELALEQLHYKQNFENILENKIVNILAPIVGGKNkVVARVNAEFDFSQKKSTKETFDPNN------------------V 292 Helicobacter py...
Q44912       314 IISSQTQKKEYQGQGYSp-WGPPGQEGN----TP-PEYQDLSDITGKYNESQEIKN------VALNEKKSTSEKEPARIV 381 Borrelia burgdo...
P25798       290 LRSRQLNESEQSGSGYP--GGVPGALSNqpapANnAPISTPPANQNNRQQQASTTSnsgprsTQRNETSNYEVDRTIRHT 367 Escherichia col...
P23447       298 AVSAEKVSETYQGDGAAn-GGTAGTGEE--------DVTNYKADGENTESGNYEKN-------S-N-KINYEVNRIHKEI 359 Bacillus subtil...
WP_000364750 293 VRSEQNLEEKKEGASKKqvGGVPGVVSN----IG--PVQGLKDN---KEPEKYEKS-------Q-N-TTNYEVGKTISEI 354 Helicobacter py...
Q44912       382 GVSLGIFVDGIWNFVYDekgDFVIENGMrkreYKPMALEEIKNIEDVLQSSFEYKPERGDSITVRNISFDr----MNEFR 457 Borrelia burgdo...
P25798       368 KMNVGDVQRLSVAVVVN---YKTLPDGK----PLPLSNEQMKQIEDLTREAMGFSEKRGDSLNVVNSPFN-----SSDES 435 Escherichia col...
P23447       360 AESPYKVRDLGIQVMVE------PPDAKn---TASLSTERQDDIQKILSTVVRTSLDK-DETQNQNLSDAd----INNKI 425 Bacillus subtil...
WP_000364750 355 KGEFGTLVRLNAAVVVDgkyKIALKDGVntleYEPLSDESLQKINALVKQAIGYNQNRGDDVAVSNFEFNpmapvIDNAT 434 Helicobacter py...
Q44912       458 EIDENYFASERFKYFLFIASIVFSLLILVFTIFFAISRELERRRRLREEELAKQAHLRRQQALMDGGDDIGVDDVV---- 533 Borrelia burgdo...
P25798       436 GGELPFWQQQAFIDQLLAAGRWLLVLLVAWLLWRKAVRPQLTRRAEAMKAVQQQAQAREEVEDAVEVRLSKDEQLQq--- 512 Escherichia col...
P23447       426 VVSVQPFDGKVNLDTNTEES--SGIPLWAYIVGGVLIAAIIVLIIMLIRKKRAQEDEFEEYEYEVPQEPINLPDIN---- 499 Bacillus subtil...
WP_000364750 435 LSEKIMHKTQKILGSFTPLIKYILVFIVLFIFYKKVIVPFSERMLEVVPDEDKEVKSMFEEMDEEEDELNKLGDLRkkve 514 Helicobacter py...
Q44912       534 --GGIREGDE------LQSNAELLAR--EKP----EDVAKLIRTWLLKNA 569 Borrelia burgdorferi B31
P25798       513 --RRANQRLGa-----EVMSQRIREMsdNDP----RVVALVIRQWINNDH 551 Escherichia coli K-12
P23447       500 --EEENETAE------SVRRKQLEKMakDKP----EDFAKLLRSWLAED- 536 Bacillus subtilis subsp. subtilis str. 168
WP_000364750 515 dqLGLNASFSeeevryEIILEKIRGTlkERPdeiaMLFKLLIKDEISSDG 564 Helicobacter pylori
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap