2O1S


Conserved Protein Domain Family
dxs

?
TIGR00204: dxs 
Click on image for an interactive view with Cn3D
1-deoxy-D-xylulose-5-phosphate synthase
DXP synthase is a thiamine diphosphate-dependent enzyme related to transketolase and the pyruvate dehydrogenase E1-beta subunit. By an acyloin condensation of pyruvate with glyceraldehyde 3-phosphate, it produces 1-deoxy-D-xylulose 5-phosphate, a precursor of thiamine diphosphate (TPP), pyridoxal phosphate, and the isoprenoid building block isopentenyl diphosphate (IPP). [Biosynthesis of cofactors, prosthetic groups, and carriers, Other, Biosynthesis of cofactors, prosthetic groups, and carriers, Pyridoxine, Biosynthesis of cofactors, prosthetic groups, and carriers, Thiamine]
Statistics
?
PSSM-Id: 129308
View PSSM: TIGR00204
Aligned: 6 rows
Threshold Bit Score: 1048.98
Threshold Setting Gi: 13124120
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2O1S_A        11 LALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTG 90  Escherichia coli
P45205        11 LSLINSPEDLRLLNKDQLPQLCQELRAYLLESVSQTSGHLASGLGTVELTVALHYVYKTPFDQLIWDVGHQAYPHKILTG 90  Haemophilus inf...
P54523         3 LLSIQDPSFLKNMSIDELEKLSDEIRQFLITSLSASGGHIGPNLGVVELTVALHKEFNSPKDKFLWDVGHQSYVHKLLTG 82  Bacillus subtil...
O25121         1 MILQNKTFDLNPNDIAGLELVCQTLRNRILEVVSANGGHLSSSLGAVELIVGMHALFDCQKNPFIFDTSHQAYAHKLLTG 80  Helicobacter py...
WP_000006797  11 LALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELTVALHYVYNTPFDQLIWDVGHQAYPHKILTG 90  Enterobacteriaceae
P73067         3 ISELTHPNELKGLSIRELEEVSRQIREKHLQTVATSGGHLGPGLGVVELTVALYSTLDLDKDRVIWDVGHQAYPHKMLTG 82  Synechocystis s...
2O1S_A        91 RRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGXAFEAXNHAGDI 170 Escherichia coli
P45205        91 RREQMSTIRQKDGIHPFPWREESEFDVLSVGHSSTSISAGLGIAVAAERENAGRKTVCVIGDGAITAGMAFEALNHAGAL 170 Haemophilus inf...
P54523        83 RGKEFATLRQYKGLCGFPKRSESEHDVWETGHSSTSLSGAMGMAAARDIKGTDEYIIPIIGDGALTGGMALEALNHIGDE 162 Bacillus subtil...
O25121        81 RFESFSTLRQFKGLSGFTKPSESAYDYFIAGHSSTSVSIGVGVAKAFCLKQALGMPIALLGDGSISAGIFYEALNELGDR 160 Helicobacter py...
WP_000006797  91 RRDKIGTIRQKGGLHPFPWRGESEYDVLSVGHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDI 170 Enterobacteriaceae
P73067        83 RYHDFHTLRQKDGVAGYLKRSESRFDHFGAGHASTSISAGLGMALARDAKGEDFKVVSIIGDGALTGGMALEAINHAGHL 162 Synechocystis s...
2O1S_A       171 -RPDXLVILNDNEXSISENVGALNNHLAQLLSGKLYSSLREGGKKVFSGVPPIKE----LLKRTEEHIKGXVVP--GTLF 243 Escherichia coli
P45205       171 -HTDMLVILNDNEMSISENVGALNNHLARIFSGSLYSTLRDGSKKILDKVPPIKN----FMKKTEEHMKGVMFSpeSTLF 245 Haemophilus inf...
P54523       163 -KKDMIVILNDNEMSIAPNVGAIHSMLGRLRTAGKYQWVKDELEYLFKKIPAVGGklaaTAERVKDSLKYMLVS--GMFF 239 Bacillus subtil...
O25121       161 -KYPMIMILNDNEMSISTPIGALSKALSQLMKGPFYQSFRSKVKKILSTLPESVNy---LASRFEESFK-LITP--GVFF 233 Helicobacter py...
WP_000006797 171 -RPDMLVILNDNEMSISENVGALNNHLAQLLSGKLYSSLREGGKKVFSGVPPIKE----LLKRTEEHIKGMVVP--GTLF 243 Enterobacteriaceae
P73067       163 pHTRLMVILNDNEMSISPNVGAISRYLNKVRLSSPMQFLTDNLEEQIKHLPFVGDsltpEMERVKEGMKRLVVPkvGAVI 242 Synechocystis s...
2O1S_A       244 EELGFNYIGPVDGHDVLGLITTLKNXRDLKGPQFLHIXTKKGRGYEPAEKDPIT-FHAVPKFDPSSG-CLPKSSGGlPSY 321 Escherichia coli
P45205       246 EELGFNYIGPVDGHNIDELVATLTNMRNLKGPQFLHIKTKKGKGYAPAEKDPIG-FHGVPKFDPISG-ELPKNNSK-PTY 322 Haemophilus inf...
P54523       240 EELGFTYLGPVDGHSYHELIENLQYAKKTKGPVLLHVITKKGKGYKPAETDTIGtWHGTGPYKINTG-DFVKPKAAaPSW 318 Bacillus subtil...
O25121       234 EELGINYIGPINGHDLSAIIETLKLAKELKEPVLIHAQTLKGKGYKIAEGRYEK-WHGVGPFDLDTG-LSKKSKSAiLSP 311 Helicobacter py...
WP_000006797 244 EELGFNYIGPVDGHDVLGLITTLKNMRDLKGPQFLHIMTKKGRGYEPAEKDPIT-FHAVPKFDPSSG-CLPKSSGGlPSY 321 Enterobacteriaceae
P73067       243 EELGFKYFGPIDGHSLQELIDTFKQAEKVPGPVFVHVSTTKGKGYDLAEKDQVG-YHAQSPFNLSTGkAYPSSKPKpPSY 321 Synechocystis s...
2O1S_A       322 SKIFGDWLCETAAKDNKLXAITPAXREGSGXVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYD 401 Escherichia coli
P45205       323 SKIFGDWLCEMAEKDAKIIGITPAMREGSGMVEFSQRFPKQYFDVAIAEQHAVTFATGLAIGGYKPVVAIYSTFLQRAYD 402 Haemophilus inf...
P54523       319 SGLVSGTVQRMAREDGRIVAITPAMPVGSKLEGFAKEFPDRMFDVGIAEQHAATMAAAMAMQGMKPFLAIYSTFLQRAYD 398 Bacillus subtil...
O25121       312 TEAYSNTLLELAKKDEKIVGVTAAMPSGTGLDKLIDAYPLRFFDVAIAEQHALTSSSAMAKEGFKPFVSIYSTFLQRAYD 391 Helicobacter py...
WP_000006797 322 SKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFPDRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYD 401 Enterobacteriaceae
P73067       322 SKVFAHTLTTLAKENPNIVGITAAMATGTGLDKLQAKLPKQYVDVGIAEQHAVTLAAGMACEGIRPVVAIYSTFLQRGYD 401 Synechocystis s...
2O1S_A       402 QVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEXVIXTPSDENECRQXLYTGYHYNdGPSAVRYPRGNA 481 Escherichia coli
P45205       403 QLIHDVAIQNLPVLFAIDRAGIVGADGATHQGAFDISFMRCIPNMIIMTPSDENECRQMLYTGYQCG-KPAAVRYPRGNA 481 Haemophilus inf...
P54523       399 QVVHDICRQNANVFIGIDRAGLVGADGETHQGVFDIAFMRHIPNMVLMMPKDENEGQHMVHTALSYDeGPIAMRFPRGNG 478 Bacillus subtil...
O25121       392 SIVHDACISSLPIKLAIDRAGIVGEDGETHQGLLDVSYLRSIPNMVIFAPRDNETLKNAVRFANEHDsSPCAFRYPRGSF 471 Helicobacter py...
WP_000006797 402 QVLHDVAIQKLPVLFAIDRAGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNdGPSAVRYPRGNA 481 Enterobacteriaceae
P73067       402 QIIHDVCIQKLPVFFCLDRAGIVGADGPTHQGMYDIAYLRCIPNLVLMAPKDEAELQQMLVTGVNYTgGAIAMRYPRGNG 481 Synechocystis s...
2O1S_A       482 VGVELTPL--EKLPIGKGIVKRRGEKLAILNFGTLXPEAAKVAESLN-----ATLVDXRFVKPLDEALILEXAASHEALV 554 Escherichia coli
P45205       482 VGVKLTPL--EMLPIGKSRLIRKGQKIAILNFGTLLPSALELSEKLN-----ATVVDMRFVKPIDIEMINVLAQTHDYLV 554 Haemophilus inf...
P54523       479 LGVKMDEQl-KTIPIGTWEVLRPGNDAVILTFGTTIEMAIEAAEELQkeglsVRVVNARFIKPIDEKMMKSILKEGLPIL 557 Bacillus subtil...
O25121       472 ALKEGVFEp-SGFVLGQSELLKKEGEILLIGYGNGVGRAHLVQLALKeknieCALLDLRFLKPLDPNLS-AIVAPYQKLY 549 Helicobacter py...
WP_000006797 482 VGVELTPL--EKLPIGKGIVKRRGEKLAILNFGTLMPEAAKVAESLN-----ATLVDMRFVKPLDEALILEMAASHEALV 554 Enterobacteriaceae
P73067       482 IGVPLMEEgwEPLEIGKAEILRSGDDVLLLGYGSMVYPALQTAELLHehgieATVVNARFVKPLDTELILPLAERIGKVV 561 Synechocystis s...
2O1S_A       555 TVEENAIXGGAGSGVNEVLXAHR-KPVPVLNIGLPDFFIPQGTQEEXRAELGLDAAGXEAKIKAWLA 620 Escherichia coli
P45205       555 TLEENAIQGGAGSAVAEVLNSSG-KSTALLQLGLPDYFIPQATQQEALADLGLDTKGIEEKILNFIA 620 Haemophilus influenzae Rd KW20
P54523       558 TIEEAVLEGGFGSSILEFAHDQGeYHTPIDRMGIPDRFIEHGSVTALLEEIGLTKQQVANRIRLLMP 624 Bacillus subtilis subsp. sub...
O25121       550 VFSDNYKLGGVASAILEFLSEQN-ILKPVKSFEIIDEFIMHGNTALVEKSLGLDTESLTDAILKDLG 615 Helicobacter pylori 26695
WP_000006797 555 TVEENAIMGGAGSGVNEVLMAHR-KPVPVLNIGLPDFFIPQGTQEEMRAELGLDAAGMEAKIKAWLA 620 Enterobacteriaceae
P73067       562 TMEEGCLMGGFGSAVAEALMDNN-VLVPLKRLGVPDILVDHATPEQSTVDLGLTPAQMAQNIMASLF 627 Synechocystis sp. PCC 6803 s...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap