Conserved Protein Domain Family
cydB

?
TIGR00203: cydB 
cytochrome d oxidase, subunit II (cydB)
part of a two component cytochrome D terminal complex. Terminal reaction in the aerobic respiratory chain. [Energy metabolism, Electron transport]
Statistics
?
PSSM-Id: 129307
View PSSM: TIGR00203
Aligned: 4 rows
Threshold Bit Score: 474.74
Threshold Setting Gi: 2829797
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P11027   1 MIDYEVLRFIWWLLVGVLLIGFAVTDGFDMGVGMLTRFLGRNDTERRIMINSIAPHWDGNQVWLITAGGALFAAWPMVYA 80  Escherichia coli
P45020   1 MIDYEFLRFIWWVLVIVLLIGFSVTDGFDMGVTALLPVIGKKEVERRIMINTIAPHWDGNQVWLLTAGGAIFAAWPIVYA 80  Haemophilus influenza...
P26458   1 MFDYETLRFIWWLLIGVILVVFMISDGFDMGIGCLLPLVARNDDERRIVINSVGAHWEGNQVWLILAGGALFAAWPRVYA 80  Escherichia coli K-12
P94365   1 ---MASLHDLWFILVAVLFVGFFFLEGFDFGVGMATRFLGHNELERRVLINTIGPFWDANEVWLLTGAGAIFAAFPNWYA 77  Bacillus subtilis sub...
P11027  81 AAFSGFYVAMILVLASLFFRPVGFDYRSKIEETRWRNMWDWGIFIGSFVPPLVIGVAFGNLLQGVPFNVDEYLRLYYTGN 160 Escherichia coli
P45020  81 VSFSGFYIALVLVLAALFLRPLGFEYRAKIDNPTWRSVWDWGLFAGGFVPALVFGVAFGNLLQGVPFHFNELTQVTYTGS 160 Haemophilus influenza...
P26458  81 AAFSGFYVAMILVLCSLFFRPLAFDYRGKIADARWRKMWDAGLVIGSLVPPVVFGIAFGNLLLGVPFAFTPQLRVEYLGS 160 Escherichia coli K-12
P94365  78 TMLSGYYIPFVIVLLALMGRGVAFEFRGKVDHLKWVKVWDWVVFFGSLIPPFVLGVLFTTLFRGMPIDADMNIHAHVS-- 155 Bacillus subtilis sub...
P11027 161 FFQLLNPFGLLAGVVSVGMIITQGATYLQMRTVGELHLRTRATAQVAALVTLVCFALAGVWvMYGIDGYVVKStMDHYAA 240 Escherichia coli
P45020 161 FFELLNPFALLCGVISLSMLVTHGANWLQMKTTEALRDRARTVSQIGSIVTLIAFVLAGVW-LYSKDGYVVTStIDHFAP 239 Haemophilus influenza...
P26458 161 FWQLLTPFPLLCGLLSLGMVILQGGVWLQLKTVGVIHLRSQLATKRAALLVMLCFLLAGYWlWVGIDGFVLLA-QDANGP 239 Escherichia coli K-12
P94365 156 --DYINVYSILGGVTVTLLCFQHGLMFITLRTIGDLQNRARKMAQKIMGVVFVAVLAFAALsAYQTDMFTRRG------- 226 Bacillus subtilis sub...
P11027 241 SNPLNKEVVREAGAWLVNFNNTPILWAIPALGVVLPLLTILTARMDKAAWAFVFSSLTLACIILTAGIAMFPFVMPSSTM 320 Escherichia coli
P45020 240 SSPMNKEVAVETGAWFRNFNEMPILWIFPALAVVAALLNAAFSKANRCGFAFFFSALTMAGVIITAAVSMFPFVMPSSSH 319 Haemophilus influenza...
P26458 240 SNPLMKLVAVLPGAWMNNFVESPVLWIFPLLGFFCPLLTVMAIYRGRPGWGFLMASLMQFGVIFTAGITLFPFVMPSSVS 319 Escherichia coli K-12
P94365 227 ---------------------E-ITIPLAVLIVICFMLAAVFIRKKKDGWTFGMTGAGLALTVGMIFISLFPRVMVSSLH 284 Bacillus subtilis sub...
P11027 321 MNASLTMWDATSSQLTLNVMTWVAVVLVPIILLYTAWCYWKMFGRITKEDIERNTHSLY 379 Escherichia coli
P45020 320 PEQSLLMWDSTSSELTLTLMLIFAVVFVVIALAYTIWSYSKMFGRLDANFIDKNKHSLY 378 Haemophilus influenzae Rd KW20
P26458 320 PISSLTLWDSTSSQLTLSIMLVIVLIFLPIVLLYTLWSYYKMWGRMTTETLRRNENELY 378 Escherichia coli K-12
P94365 285 SAYDLTVANASSGDYSLKVMSIAALTLLPFVIGSQIWSYYVFRKRVS-----HKEPMTY 338 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap