Conserved Protein Domain Family
cinA_nterm

?
TIGR00200: cinA_nterm 
competence/damage-inducible protein CinA N-terminal domain
cinA is a DNA damage- or competence-inducible protein that is polycistronic with recA in a number of species [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 161761
View PSSM: TIGR00200
Aligned: 3 rows
Threshold Bit Score: 636.179
Threshold Setting Gi: 18206231
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q55760   1 MAAEIICVGTELLLGEILNSNSQYLAQELARLGIPHYFQTVVGDNPERIKRAIAIARERAQILIFTGGLGPTPDDLTTET 80  Synechocystis sp. PCC...
P46323   5 KKAEIIAVGSELLLGQIANTNAQFISKQLAEIGVNVFYHTAVGDNPERLKQVIRIAEERSDFIIFSGGLGPTKDDLTKET 84  Bacillus subtilis sub...
P77808   2 LKVEMLSTGDEVLHGQIVDTNAAWLADFFFHQGLPLSRRNTVGDNLDDLVTILRERSQHADVLIVNGGLGPTSDDLSALA 81  Escherichia coli K-12
Q55760  81 IADFFRTPLQENIAVIADIEAKFAQTGRPMAANNRKQALLPLGAELLANATGTAPGMIWHPQPDLLILtFPGVPSEMRQM 160 Synechocystis sp. PCC...
P46323  85 IANTLGRPLVLNDEAFQSIEDYFKRTKRTMSPNNRKQALVIEGSDVLANHFGMAPGMLTEHESRYYML-LPGPPSELRPM 163 Bacillus subtilis sub...
P77808  82 AATAKGEGLVLHEAWLKEMERYFHERGRVMAPSNRKQAELPASAEFINNPVGTACG-FAVQLNRCLMFfTPGVPSEFKVM 160 Escherichia coli K-12
Q55760 161 WQGVAVPYLQSQGWGKTTIYSRVLRFQGIGESALAEKVTDFF-TLTNPTVAPYAGKGEVRLRISCPASSEALAKEIIDPI 239 Synechocystis sp. PCC...
P46323 164 FENEAKPLLLKKMGSNEKIVSTVLRFFGIGESQLEADLEDIIdAQTNPTIAPLAADGEVTLRLTAKHADEKETERLLKET 243 Bacillus subtilis sub...
P77808 161 VEHEILPRLRERFSLPQPPVCLRLTTFGRSES----DLAQSLdTLQLPPGVTMGYRSSMPIIELKLTGPASEQQ-AMEKL 235 Escherichia coli K-12
Q55760 240 AEEIKAIAGLDYFGQDEDTIASVVGALLRERGETVAVAESCTGGGLGALLTDQPGSSDYFWGGVIAYYNQVKIKLLGVDP 319 Synechocystis sp. PCC...
P46323 244 EAVILERVGEFFYGYDDTSLVKELSIACKEKGITISAAESFTGGLFSEWLTDHSGASKLFAGGVVCYTNDVKQNVLGVKK 323 Bacillus subtilis sub...
P77808 236 WLDVKRVAGQSVIFEGTEGLPAQISRELQNRQFSLTLSEQFTGGLLALQLSR---------AGAPLLACEVVPSQEETLA 306 Escherichia coli K-12
Q55760 320 EIIEYCGAVSEATAEAMALGVKERLGTDWGIAITGIAGPgGGTEEKPIGTVYVGLADPHGQ-ASHILLQFGDRRGrewIR 398 Synechocystis sp. PCC...
P46323 324 ETLDRFGAVSKECASELAKGVQKLTGSDIGISFTGVAGP-DAQEGHEPGHVFIGISANGKE-EVHEFHFAGSRTG---IR 398 Bacillus subtilis sub...
P77808 307 QTAHWITERRANHFAGLALAVSGFENEHLNFALATPDGT--FALRVRFSTTRYSLAIRQEVcAMMALNMLRRWLN---GQ 381 Escherichia coli K-12
Q55760 399 YLSACQALDHLRRRLQSS 416 Synechocystis sp. PCC 6803 substr. Kazusa
P46323 399 KRGAKYGCHLILKLLEQK 416 Bacillus subtilis subsp. subtilis str. 168
P77808 382 DIASEHGWIEVVESMTLS 399 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap