Conserved Protein Domain Family
PncC_domain

?
TIGR00199: PncC_domain 
amidohydrolase, PncC family
CinA is a DNA damage- or competence-inducible protein that is polycistronic with recA in a number of species. Several bacterial species have a protein consisting largely of the C-terminal domain of CinA but lacking the N-terminal domain, including nicotinamide mononucleotide (NMN) deamidase (3.5.1.42) proteins PncC in Shewanella oneidensis and ygaD in E. coli. [DNA metabolism, DNA replication, recombination, and repair]
Statistics
?
PSSM-Id: 129303
View PSSM: TIGR00199
Aligned: 6 rows
Threshold Bit Score: 214.191
Threshold Setting Gi: 401539
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q55760       263 VGALLRERGETVAVAESCTGGGLGALLTDQPGSSDYFWGGVIAYYNQVKIKLLGVDPEIIEYCGAVSEATAEAMALGVKE 342 Synechocystis s...
P31131        24 LSQRLIADQLRLTTAESCTGGKLASALCAAEDTPKFYGAGFVTFTDQAKMKILSVSQQSLERYSAVSEKVAAEMATGAIE 103 Escherichia col...
P41053        13 VGQALKARGATVTTAESCTGGWVAKVITDIAGSSAWFERGFVTYSNEAKAQMIGVREETLAQHGAVSEPVVVEMAIGALK 92  Escherichia coli
P46323       267 LSIACKEKGITISAAESFTGGLFSEWLTDHSGASKLFAGGVVCYTNDVKQNVLGVKKETLDRFGAVSKECASELAKGVQK 346 Bacillus subtil...
P47361         6 IAEKLQKLQLSVATAESVTGGLLAHCLTSIDGASNYFNGGVIAYNNQVKINLLNVQSSTIANHGAVSSFCAREMAVGVKQ 85  Mycoplasma geni...
WP_000669256  70 LIERLKSLDLKIAVAESCSGGLLSHAFTSISGASAVFMGGIVCYNEEVKRELLKVNATTLKVFGVYSEECVKEMLLGVFL 149 Helicobacter py...
Q55760       343 RLGTDWGIAITGIAGPGGGTEEKPIGTVYVGLADpHGQASHILLQFGDRrgREWIRYLSACQALDHLrrrL 413 Synechocystis sp. PCC 68...
P31131       104 RADADVSIAITGYGGPEGGEDGTPAGTVWFAWHI-KGQNYTAVMHFAGD--CETVLALAVRFALAQL---L 168 Escherichia coli K-12
P41053        93 AARADYAVSISGIAGPDGGSEEKPVGTVWFAFATaRGEGITRRECFSGD--RDAVRRQATAYALQTL---W 158 Escherichia coli
P46323       347 LTGSDIGISFTGVAGPDAQEGHEPGHV--FIGISaNGKEEVHEFHFAGS--RTGIRKRGAKYGCHLI---L 410 Bacillus subtilis subsp....
P47361        86 KFQADVGIACSGIAGSKAVENKAIGLLFFCIIIGnKAYDFEFEMNQNNRkdNIELFTNKILESFHYLltkL 156 Mycoplasma genitalium G37
WP_000669256 150 NFKVDLALAMSGVAGPNGGNKANPVGTIYIGAQKlGSQALIDRCFFEGN--RESIQNKSVEHALNMLarmL 218 Helicobacter pylori
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap