1E9Y


Conserved Protein Domain Family
urease_beta

?
TIGR00192: urease_beta 
Click on image for an interactive view with Cn3D
urease, beta subunit
In a number of species, including B.subtilis, Synechocystis, and Haemophilus influenzae, urease subunits beta and gamma are encoded as separate polypeptides. In Helicobacter pylori UreA and in the fission yeast Schizosaccharomyces pombe, beta subunit-like sequence follows gamma subunit-like sequence in a single chain; the fission yeast protein contains additional C-terminal regions. [Central intermediary metabolism, Nitrogen metabolism]
Statistics
?
PSSM-Id: 129296
View PSSM: TIGR00192
Aligned: 5 rows
Threshold Bit Score: 180.407
Threshold Setting Gi: 2501625
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1E9Y_A 106 LVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIAAGTAVRFEPGEEKSVE 185 Helicobacter pylori
P74386   4 MIPGEIITPEGDIELNVGRSTCTINVANTGDRPIQVGSHYHFYEVNAALQFDRDLAKGMRLDIPAGTAVRFEPGDEKNVN 83  Synechocystis sp. PCC...
P14916 106 LVPGELFLKNEDITINEGKKAVSVKVKNVGDRPVQIGSHFHFFEVNRCLDFDREKTFGKRLDIASGTAVRFEPGEEKSVE 185 Helicobacter pylori 2...
P71035   1 MKPGAFQIAEGTITINEGREIREVTVKNTGSRSIQVGSHFHFAEANGALLFDRELAIGMRLDVPSGTSVRFEPGEQKTVS 80  Bacillus subtilis sub...
P44392   1 MIPGEYQLAEGDILANVGRKTVKIEVTNSGDRPIQVGSHYHFFETNNALKFDRTLARGMRLNVPSGNAVRFEPGEVKSVE 80  Haemophilus influenza...
1E9Y_A 186 LIDIGGNRRIFGFNALVDRQA 206 Helicobacter pylori
P74386  84 LVAYAGSREIYGFNGLVNGPL 104 Synechocystis sp. PCC 6803 substr. Kazusa
P14916 186 LIDIGGNRRIFGFNALVDRQA 206 Helicobacter pylori 26695
P71035  81 LVEIRGRKTIRGLNGMADTFI 101 Bacillus subtilis subsp. subtilis str. 168
P44392  81 LVAFGGNQIIYGFHNQIDGKL 101 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap