Conserved Protein Domain Family
thiC

?
TIGR00190: thiC 
phosphomethylpyrimidine synthase
The thiC ortholog is designated thiA in Bacillus subtilis. [Biosynthesis of cofactors, prosthetic groups, and carriers, Thiamine]
Statistics
?
PSSM-Id: 129294
View PSSM: TIGR00190
Aligned: 7 rows
Threshold Bit Score: 697.27
Threshold Setting Gi: 7388298
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P30136       147 VTQLHYARQGIITPEMEFIAIRENMGrerirsevlrhqhpgmsfgahlpenitAEFVRDEVAAGRAIIPANINHPESEPM 226 Escherichia col...
P45740       132 VTQMHYAKKGIITPEMEFIAIREHVS---------------------------PEFVRDEVASGRAIIPSNINHPESEPM 184 Bacillus subtil...
Q55894        15 VSQMHYARKGVITEEMDYVAKRENLP---------------------------VELIKDEVARGRMIIPANINHTNLEPM 67  Synechocystis s...
O27617         1 MTQMEEARKGNITPEMEEVARKENLD---------------------------IQMLIRGIANGRIVIPSNINR-ESSPC 52  Methanothermoba...
O30259         1 MTLIEDARKGVVTDFVKKAAEYEGIE---------------------------AEKLIRLISHGYVVLPKNVRREEVQPR 53  Archaeoglobus f...
O27586         1 MTQMDEAKKGVITDEMKAVAEAENVT---------------------------PEFVRRGVASGKIAIPSNLNREEVAAV 53  Methanothermoba...
WP_010870539   1 MTQMDDAKNGIITEEMKIVAEKEKID---------------------------IEKLRKLIAKGYVVILKNVNR-DTNPV 52  Methanocaldococ...
P30136       227 IIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWSTRWGADTVMDLSTG-RYIHETREWILRNSPVPIGTVPIYQA---LEK 302 Escherichia col...
P45740       185 IIGRNFHVKINANIGNSAVTSSIEEEVEKMTWAIRWGADTMMDLSTG-KDIHTTREWIIRNCPVPVGTVPIYQA---LEK 260 Bacillus subtil...
Q55894        68 AIGIASKCKVNANIGASPNSSNIDEEVEKLLLSVKYGADTVMDLSTGgGDLDVIRTAIINASPVPIGTVPIYQA---LES 144 Synechocystis s...
O27617        53 GIGENLSTKINANIGSSSKMEDIELEVDKALAAVEYGADAVMDLSTG-PMLRDVRKAVLEAVDVPVGTVPIYEAgveAFM 131 Methanothermoba...
O30259        54 AIGMLTSTKVNANVGTSADYINVEEEVEKAIIAQKAGADAVMDLSSG-GDLDAIRKRIMEVVEVPFGTVPIYQA---ARD 129 Archaeoglobus f...
O27586        54 GIGAGLRTKVNATIGTSTDIVDFDMEEEKARIAIENRADTLMELSVG-GDLDEIRRRILDLSPIPVGSVPVYQAaieTIR 132 Methanothermoba...
WP_010870539  53 GIGQSLRTKVNANIGTSPDCVDIELEIKKAKIAEKYGADAVMDLSTG-GNLEEIRKAIMDAVKIPIGTVPIYEVgklARE 131 Methanocaldococ...
P30136       303 VNGIAEDLTWEAFRDTLLEQAEQGVDYFTIHAGVLLRYVPMTAK--RLTGIVSRGGSIMAKWCLSHHQENFLYQHFREIC 380 Escherichia col...
P45740       261 VNGVAEDLTWEIYRDTLIEQAEQGVDYFTIHAGVLLRYVPLTAK--RTTGIVSRGGAIMAQWCLAHHQESFLYTHFEEIC 338 Bacillus subtil...
Q55894       145 VHGSIENLTPDDFLHIIEKHAQQGVDYMTIHAGLLIEYLPLVKS--RITGIVSRGGGIIAKWMLHHHKQNPLYTHFDEII 222 Synechocystis s...
O27617       132 SDGAVVDMDEDDMFRAIENQARDGVDFMTVHSGITLETVERAQRsgRIMGIVSRGGAFLAAWIMQNQEENPLYSNYEYLL 211 Methanothermoba...
O30259       130 CH-RVVDMDEDDFFRVVEKHAKDGVDFMTIHAGVNWVSVERLRRskRLLGVVSRGGAITIGWMLHNEKENPYYKDFDYLL 208 Archaeoglobus f...
O27586       133 EKGASIYMDEDVMFRAIEKQAKDGIDFMAIHCSVNRETLRRLKRqgREGGLVSRGGAFVSAWMVENGLENPLYENFDYIL 212 Methanothermoba...
WP_010870539 132 KYGRVIDMNEDLMFKVIEKQAKEGVDFMTLHCGITKQSVERLKRsgRIMGVVSRGGAFLTAYILYHNEENPLYKNFDYLL 211 Methanocaldococ...
P30136       381 EICAAYDVSLSLGDGLRPGSIQDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMQMIRRNMTEELEHCHEAPFY 460 Escherichia col...
P45740       339 EIMKMYDIAFSLGDGLRPGSIADANDEAQFAELETLGELTQIAWKHDVQVMIEGPGHVPMHKIKENVDKQMDICKEAPFY 418 Bacillus subtil...
Q55894       223 EIFKKYDVSFSLGDSLRPGCTHDASDDAQLSELKTLGQLTRRAWEHDVQVMVEGPGHVPIDQIEFNVKKQMEECSEAPFY 302 Synechocystis s...
O27617       212 EVAYEYDVTLSLGDGLRPGCLADASDIPQISELLTLAELVERARDADVQCMVEGPGHMPLDQIAANMKIQKEVCDGAPFY 291 Methanothermoba...
O30259       209 EILKEYDVTISLGDAYRPGCIHDAGDRAKYTEFIMLGELVEKCREKGVQCMVEGPGHVPLDQIETSVRAMKSVTDNAPLY 288 Archaeoglobus f...
O27586       213 EIAKEHDFVLSMANAMRAGAIADSTDRAQVQELIVLGELIDRAREAGVQTIVEGPGHIPLNEIKANVILQKKLCRGAPFY 292 Methanothermoba...
WP_010870539 212 DILKEHDVTISLGDGMRPGCLADNTDRAQIEELITLGELVERCREKGVQCMVEGPGHIPINYIETNIRLQKSLCKNAPFY 291 Methanocaldococ...
P30136       461 TLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPKEHLGLPNKEDVKQGLITYKIAAHAADLAK-GHPG-AQIRDN 538 Escherichia col...
P45740       419 TLGPLTTDIAPGYDHITSAIGAAMIGWYGTAMLCYVTPKEHLGLPNRDDVREGVITYKIAAHAADLAK-GHPG-AQIRDD 496 Bacillus subtil...
Q55894       303 VLGPLVTDIAPGYDHITSAIGAAIAGWHGTAMLCYVTPKEHLGLPNAEDVRNGLIAYKIAAHAADIAR-HRPG-ARDRDD 380 Synechocystis s...
O27617       292 VLGPIVTDMAPGYDHISAAIGGAVAAMNGADFLCYVTPAEHLAIPGVQDVIEGVIASRIAAQAADAAR-KLPG-AWDSEL 369 Methanothermoba...
O30259       289 LLGPLVTDIAAGYDHIAAAIGAAIAGMAGADFICYVTPSEHLALPTVEDVREGVIAAKIAAHAIDLIKeGQRErARQRDY 368 Archaeoglobus f...
O27586       293 MLGPIVTDIGAGYDHIVSSIGAAASAAAGADFICYVTPAEHLALPYPDDVKEGVIATRIGAYVGDMVK-GIHN--GEKDL 369 Methanothermoba...
WP_010870539 292 VLGPIVTDIAPGYDHITAAIGGALAGYYGADFLCYVTPSEHLRLPTIEDVKEGVIATKIAAQAADVAK-GNKl-AWEKET 369 Methanocaldococ...
P30136       539 AMSKARFEFRWEDQFNLALDPFTARAYHDETLPQESGkvahFCSMCGpKFCSMKISQEVRD 599 Escherichia coli K-12
P45740       497 ALSKARFEFRWRDQFNLSLDPERALEYHDETLPAEGAktahFCSMCGpKFCSMRISQDIRD 557 Bacillus subtilis subsp. subtilis ...
Q55894       381 ELSKARYNFDWNRQFELSLDPERAKEYHDETLPADIYktaeFCSMCGpKFCPMQTKVDAEM 441 Synechocystis sp. PCC 6803 substr....
O27617       370 EMADARRSFDWDKQFKLAFDSKKPYEYRMQCPIEDSE----MCSMCG-EYCALRILREDR- 424 Methanothermobacter thermautotroph...
O30259       369 EMSLARKNLDWERQFELSIDPEKAREIYSRRKSESE-----ACSMCG-DLCAIKLVKEAFE 423 Archaeoglobus fulgidus DSM 4304
O27586       370 EMANARKKLNWEAQFDAAMCPAEARRIRDERPPEDPD----TCTMCG-EYCAVKIVNEWLD 425 Methanothermobacter thermautotroph...
WP_010870539 370 EMAYARKNHDWEKQFELAIDKEKARKMREEIPSKEEK----ACSICG-DYCALLMVEELGK 425 Methanocaldococcus jannaschii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap