1VI1


Conserved Protein Domain Family
plsX

?
TIGR00182: plsX 
Click on image for an interactive view with Cn3D
fatty acid/phospholipid synthesis protein PlsX
This protein of fatty acid/phospholipid biosynthesis, called PlsX after the member in Streptococcus pneumoniae, is proposed to be a phosphate acyltransferase that partners with PlsY (TIGR00023) in a two-step 1-acylglycerol-3-phosphate biosynthesis pathway alternative to the one-step PlsB (EC 2.3.1.15) pathway. [Fatty acid and phospholipid metabolism, Biosynthesis]
Statistics
?
PSSM-Id: 129286
View PSSM: TIGR00182
Aligned: 7 rows
Threshold Bit Score: 444.969
Threshold Setting Gi: 40889972
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1VI1_A        11 GGDHAPKAVIDGVIKgIEAFDDLHITLVGDKTTIESHLTTTSDR----ITVLHADEVIEPTDEPVRAvRRKKNSSXVLXA 86  Bacillus subtilis
P73950        14 GGDYAPEEIVIGAIR-ASQELDVDIFLVGDRQAIEDCLNRHPHQgi-nLTIVDAEGVVEMEEDAVVV-RRKPKASINVAM 90  Synechocystis s...
Q49427        11 GFENKPSEAIEAVLKyWSFHQDLNFILIGDEKAFDG-LDILPKN----ITKKLANSFIEMTDTPLSA-RRKVNSSMQIAI 84  Mycoplasma geni...
P75232        11 GFENHPREAIDAVLEyWSYHQELEFILVGDEKTFDG-LDYLPKN----ITKQLASSCIDMTDTPLTA-RRKVNNSMQKAI 84  Mycoplasma pneu...
WP_014639043   2 GGDFGPSVTVPAALQaLNSNSQLTLLLVGNSDAITPLLAKADFEqrsrLQIIPAQSVIASDARPSQAiRASRGSSMRVAL 81  Escherichia coli
WP_001862855   9 GADHGVLPVIEGVSR-ALENKSFSTVLVGDKDKATPFISKELASk---VEMIHTQDYIKMEEAATEAiKRK-ESSIYLGM 83  Helicobacter py...
P71018         9 GGDHAPKAVIDGVIKgIEAFDDLHITLVGDKTTIESHLTTTSDR----ITVLHADEVIEPTDEPVRAvRRKKNSSMVLMA 84  Bacillus subtil...
1VI1_A        87 QEVAENRADACISAGNTGALXTAGLFIVGRIKGIDRPALAPTLPTVS-GDGFLLLDVGANVDAKPEHLVQYAIXGSVYSQ 165 Bacillus subtilis
P73950        91 NLVKEKQADAVVSAGHSGAAMAAALLRLGRLKGIDRPAIGTLFPTMVpGKSVIVLDVGANVDCKPKYLEQFALMGTVYSQ 170 Synechocystis s...
Q49427        85 NLVREGNADVVISAGSSAVYASLTNDAFGKINKNTKSAFMSYVPTDN-NNWFYFLDVGANKYFTGKELYFLGLMADIFVK 163 Mycoplasma geni...
P75232        85 NLVRDGAADVVISAGSSAVYASLTYDGFGKIHKDVKSAFMSYVPTAN-NDWFYFLDVGANKNFTGKELYFLGLMADIFVK 163 Mycoplasma pneu...
WP_014639043  82 ELVKEGRAQACVSAGNTGALMGLAKLLLKPLEGIERPALVTVLPHQQ-KGKTVVLDLGANVDCDSTMLVQFAIMGSVLAE 160 Escherichia coli
WP_001862855  84 DILKNG-ADALISAGHSGATMGLATLRLGRIKGVERPAICTLMPSVG-KRPSVLLDAGANTDCKPEYLIDFALMGYEYAK 161 Helicobacter py...
P71018        85 QEVAENRADACISAGNTGALMTAGLFIVGRIKGIDRPALAPTLPTVS-GDGFLLLDVGANVDAKPEHLVQYAIMGSVYSQ 163 Bacillus subtil...
1VI1_A       166 QVRGVTSPRVGLLNVGTEDKKGNELTKQTFQILKETANINFIGNVEARDLLDDVADVVVTDGFTGNVTLKTLEGSALSIF 245 Bacillus subtilis
P73950       171 YVLGVDSPKVGLLNIGEESNKGNTLALQTHELLQSNPEIPFVGNAEGRDVLSGNFDVIVCDGFVGNIVLKFAEAVGEILL 250 Synechocystis s...
Q49427       164 KTTTKKTPKIGLLNIGTEENKGFDYHQEAFKLLKADKNLNFLGFVESRFLLDGICDILIADGYSGNLVLKAMEGTFKTIA 243 Mycoplasma geni...
P75232       164 KTTNKISPRIALLNIGTEIHKGFDYHQEGYQLLNEDKHLNFTGFIEPRFLLDGVCDILVADGYSGNLVLKSMEGTFKTIA 243 Mycoplasma pneu...
WP_014639043 161 EVVEIPNPRVALLNIGEEEVKGLDSIRDASAVLKTIPSINYIGYLEANELLTGKTDVLVCDGFTGNVTLKTMEGVVRMFL 240 Escherichia coli
WP_001862855 162 SVLHYDSPKVGLLSNGEEDIKGNMLVKETHKMLKAYD--FFYGNVEGSDIFKGVVDVVVCDGFMGNVVLKTTEGVASAIG 239 Helicobacter py...
P71018       164 QVRGVTSPRVGLLNVGTEDKKGNELTKQTFQILKETANINFIGNVEARDLLDDVADVVVTDGFTGNVTLKTLEGSALSIF 243 Bacillus subtil...
1VI1_A       246 KXXRDVXTSTLTSKLAAAVLKPKLKEXKXKXEYSN---YGGASLFGLKAPVIKAHGSSDSNAVFRAIRQAREXVSQNVAA 322 Bacillus subtilis
P73950       251 SIVKEELPRGWRGKLGAIILAPNLKRIKQRVDHAE---HGGALLFGVDGVCVISHGSSRSGSIFNAIRLAKEAIDNQVSV 327 Synechocystis s...
Q49427       244 RILKRGYK---RNPLAGLFSLGIIKSVAKKFDYKN---NAGAVVMGLNKLALKTHGSADKQQFLSTIRLAHLSLKSDLIN 317 Mycoplasma geni...
P75232       244 RLLKQGYK---RNPLAGLFSLGILKRIAKRFDYKN---NAGAVVIGLNKLALKTHGSADKQQFLSTIRLAHTSLKSDLIN 317 Mycoplasma pneu...
WP_014639043 241 SLLKSQGEGKKRSWWLLLLKRWLQKSLTRRFSHLNpdqYNGACLLGLRGTVIKSHGAANQRAFAVAIEQAVQAVQRQVPQ 320 Escherichia coli
WP_001862855 240 SIFKDEIKSSFKSKMGALMLKNAFDILKQKTDYAE---YGGAPLLGVNKSVIISHGKSNARAIECAIYQAISAVESQVCL 316 Helicobacter py...
P71018       244 KMMRDVMTSTLTSKLAAAVLKPKLKEMKMKMEYSN---YGGASLFGLKAPVIKAHGSSDSNAVFHAIRQAREMVSQNVAA 320 Bacillus subtil...
1VI1_A       323 LIQEEVKEEK 332 Bacillus subtilis
P73950       328 RINSSTSLLM 337 Synechocystis sp. PCC 6803 substr. Kazusa
Q49427       318 AIKTSLNNye 327 Mycoplasma genitalium G37
P75232       318 AIKSSLDNye 327 Mycoplasma pneumoniae M129
WP_014639043 321 RIAARLESVY 330 Escherichia coli
WP_001862855 317 RITQAFESLK 326 Helicobacter pylori
P71018       321 LIQEEVKEEK 330 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap