1ITW


Conserved Protein Domain Family
monomer_idh

?
TIGR00178: monomer_idh 
Click on image for an interactive view with Cn3D
isocitrate dehydrogenase, NADP-dependent, monomeric type
The monomeric type of isocitrate dehydrogenase has been found so far in a small number of species, including Azotobacter vinelandii, Corynebacterium glutamicum, Rhodomicrobium vannielii, and Neisseria meningitidis. It is NADP-specific. [Energy metabolism, TCA cycle]
Statistics
?
PSSM-Id: 129282
View PSSM: TIGR00178
Aligned: 5 rows
Threshold Bit Score: 1388.83
Threshold Setting Gi: 1708389
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1ITW_A         1 MSTP--KIIYTLTDEAPALATYSLLPIIKAFTGSSGIAVETRDISLAGRLIATFPEYLTDTQKISDDLAELGKLATTPDA 78  Azotobacter vin...
P16100         1 MSTP--KIIYTLTDEAPALATYSLLPIIKAFTGSSGIAVETRDISLAGRLIATFPEYLTDTQKISDDLAELGKLATTPDA 78  Azotobacter vin...
P50216         1 ----maKIIWTRTDEAPLLATYSLKPVVEAFAATAGIEVETRDISLAGRILAQFPERLTEDQKVGNALAELGELAKTPEA 76  Corynebacterium...
WP_003899797   1 MSAEqpTIIYTLTDEAPLLATYAFLPIVRAFAEPAGIKIEASDISVAARILAEFPDYLTEEQRVPDNLAELGRLTQLPDT 80  Mycobacterium t...
BAA03134       1 MSTDnsKIIYTITDEAPALATYSLLPIIQAYTASSGINVETRDISLAGRILANFPKYLTKEQRIDDALAELGELAQTPEA 80  Colwellia maris
1ITW_A        79 NIIKLPNISASVPQLKAAIKELQQQGYKLPDYPEEPKTDTEKDVKARYDKIKGSAVNPVLREGNSDRRAPLSVKNYARKH 158 Azotobacter vin...
P16100        79 NIIKLPNISASVPQLKAAIKELQQQGYKLPDYPEEPKTDTEKDVKARYDKIKGSAVNPVLREGNSDRRAPLSVKNYARKH 158 Azotobacter vin...
P50216        77 NIIKLPNISASVPQLKAAIKELQDQGYDIPELPDNATTDEEKDILARYNAVKGSAVNPVLREGNSDRRAPIAVKNFVKKF 156 Corynebacterium...
WP_003899797  81 NIIKLPNISASVPQLVAAIKELQDKGYAVPDYPADPKTDQEKAIKERYARCLGSAVNPVLRQGNSDRRAPKAVKEYARKH 160 Mycobacterium t...
BAA03134      81 NIIKLPNISASIPQLEAVIKELQAKGYDLPHYPAEPQNEAEESIKLTYAKILGSAVNPVLREGNSDRRAPASVKQYARNN 160 Colwellia maris
1ITW_A       159 PHKMGAWSADSKSHVAHMDNGDFYGSEKAALIGAPGSVKIELIAKDGSSTVLKAKTSVQAGEIIDSSVMSKNALRNFIAA 238 Azotobacter vin...
P16100       159 PHKMGAWSADSKSHVAHMDNGDFYGSEKAALIGAPGSVKIELIAKDGSSTVLKAKTSVQAGEIIDSSVMSKNALRNFIAA 238 Azotobacter vin...
P50216       157 PHRMGEWSADSKTNVATMDANDFRHNEKSIILDAADEVQIKHIAADGTETILKDSLKLLEGEVLDGTVLSAKALDAFLLE 236 Corynebacterium...
WP_003899797 161 PHSMGEWSMASRTHVAHMRHGDFYAGEKSMTLDRARNVRMELLAKSGKTIVLKPEVPLDDGDVIDSMFMSKKALCDFYEE 240 Mycobacterium t...
BAA03134     161 PHSMGAWSKESKSHVAHMASGDFYGSEKSVTIDGATSVNIEFVAKNGDVTLLKSKLPLLDKEIIDASVMSKSALVEFFET 240 Colwellia maris
1ITW_A       239 EIEDAKKQGVLLSVHLKATMMKVSDPIMFGQIVSEFYKDALTKHAEVLKQIGFDVNNGIGDLYARIKTLPEAKQKEIEAD 318 Azotobacter vin...
P16100       239 EIEDAKKQGVLLSVHLKATMMKVSDPIMFGQIVSEFYKDALTKHAEVLKQIGFDVNNGIGDLYARIKTLPEAKQKEIEAD 318 Azotobacter vin...
P50216       237 QVARAKAEGILFSAHLKATMMKVSDPIIFGHVVRAYFADVFAQYGEQLLAAGLNGENGLAAILSGLESLDNG--EEIKAA 314 Corynebacterium...
WP_003899797 241 QMQDAFETGVMFSLHVKATMMKVSHPIVFGHAVRIFYKDAFAKHQELFDDLGVNVNNGLSDLYSKIESLPASQRDEIIED 320 Mycobacterium t...
BAA03134     241 EINKAKEEDVLLSLHLKATMMKVSDPVMFGHAVRVFYKDVFAKHAATFEQLGVDADNGIGDVYAKIARLPAAQKEEIEAD 320 Colwellia maris
1ITW_A       319 IQAVYAQRPQLAMVNSDKGITNLHVPSDVIVDASMPAMIRDSGKMWGPDGKLHDTKAVIPDRCYAGVYQVVIEDCKQHGA 398 Azotobacter vin...
P16100       319 IQAVYAQRPQLAMVNSDKGITNLHVPSDVIVDASMPAMIRDSGKMWGPDGKLHDTKAVIPDRCYAGVYQVVIEDCKQHGA 398 Azotobacter vin...
P50216       315 FEKGLEDGPDLAMVNSARGITNLHVPSDVIVDASMPAMIRTSGHMWNKDDQEQDTLAIIPDSSYAGVYQTVIEDCRKNGA 394 Corynebacterium...
WP_003899797 321 LHRCHEHRPELAMVDSARGISNFHSPSDVIVDASMPAMIRAGGKMYGADGKLKDTKAVNPESTFSRIYQEIINFCKTNGQ 400 Mycobacterium t...
BAA03134     321 LQAVYATRPEMAMVDSDKGITNLHVPSDVIIDASMPAALRASGMMWGPDGKQKDTKFMIPDRNYAGVFSAVVDFCRENGA 400 Colwellia maris
1ITW_A       399 FDPTTMGSVPNVGLMAQKAEEYGSHDKTFQIPADGVVRVTD-ESGKLLLEQSVEAGDIWRMCQAKDAPIQDWVKLAVNRA 477 Azotobacter vin...
P16100       399 FDPTTMGSVPNVGLMAQKAEEYGSHDKTFQIPADGVVRVTD-ESGKLLLEQSVEAGDIWRMCQAKDAPIQDWVKLAVNRA 477 Azotobacter vin...
P50216       395 FDPTTMGTVPNVGLMAQKAEEYGSHDKTFRIEADGVVQVVS-SNGDVLIEHDVEANDIWRACQVKDAPIQDWVKLAVTRS 473 Corynebacterium...
WP_003899797 401 FDPTTMGTVPNVGLMAQQAEEYGSHDKTFEIPEDGVANIVDvATGEVLLTENVEAGDIWRMCIVKDAPIRDWVKLAVTRA 480 Mycobacterium t...
BAA03134     401 FNPATMGTVPNVGLMAQKAEEYGSHDKTFTMKAAGTVRVVN-SQGERLIEQEVAQGDIYRMCQVKDAPIQDWVKLAVTRA 479 Colwellia maris
1ITW_A       478 RATNTPAVFWLDPARAHDAQVIAKVERYLKDYDTSGLDIRILSPVEATRFSLARIREGKDTISVTGNVLRDYLTDLFPIM 557 Azotobacter vin...
P16100       478 RATNTPAVFWLDPARAHDAQVIAKVERYLKDYDTSGLDIRILSPVEATRFSLARIREGKDTISVTGNVLRDYLTDLFPIM 557 Azotobacter vin...
P50216       474 RLSGMPAVFWLDPERAHDRNLASLVEKYLADHDTEGLDIQILSPVEATQLSIDRIRRGEDTISVTGNVLRDYNTDLFPIL 553 Corynebacterium...
WP_003899797 481 RISGMPVLFWLDPYRPHENELIKKVKTYLKDHDTEGLDIQIMSQVRSMRYTCERLVRGLDTIAATGNILRDYLTDLFPIL 560 Mycobacterium t...
BAA03134     480 RATGTPTVFWLDENRGHDEQMIKKVNTYLADHDTTGLDIQILEPVKACEFTLARVAKGEDAISVTGNVLRDYLTDLFPIL 559 Colwellia maris
1ITW_A       558 ELGTSAKMLSIVPLMSGGGLFETGAGGSAPKHVQQFLEEGYLRWDSLGEFLALAASLEHLGNAYKNPKALVLASTLDQAT 637 Azotobacter vin...
P16100       558 ELGTSAKMLSIVPLMSGGGLFETGAGGSAPKHVQQFLEEGYLRWDSLGEFLALAASLEHLGNAYKNPKALVLASTLDQAT 637 Azotobacter vin...
P50216       554 ELGTSAKMLSVVPLMAGGGLFETGAGGSAPKHVQQVQEENHLRWDSLGEFLALAESFRHELNNNGNTKAGVLADALDKAT 633 Corynebacterium...
WP_003899797 561 ELGTSAKMLSVVPLMAGGGMYETGAGGSAPKHVKQLVEENHLRWDSLGEFLALGAGFEDIGIKTGNERAKLLGKTLDAAI 640 Mycobacterium t...
BAA03134     560 ELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVQQFEKENHLRWDSLGEFLALAASLEHVAVTTGNARAQILADTLDAAT 639 Colwellia maris
1ITW_A       638 GKILDNNKSPARKVGEIDNRgSHFYLALYWAQALAAQTEDKELQAQFTGIAKALTDNETKIVGELAAAQGKPVDIAGYYH 717 Azotobacter vin...
P16100       638 GKILDNNKSPARKVGEIDNRgSHFYLALYWAQALAAQTEDKELQAQFTGIAKALTDNETKIVGELAAAQGKPVDIAGYYH 717 Azotobacter vin...
P50216       634 EKLLNEEKSPSRKVGEIDNRgSHFWLTKFWADELAAQTEDADLAATFAPVAEALNTGAADIDAALLAVQGGATDLGGYYS 713 Corynebacterium...
WP_003899797 641 GKLLDNDKSPSRKTGELDNRgSQFYLAMYWAQELAAQTDDQQLAEHFASLADVLTKNEDVIVRELTEVQGEPVDIGGYYA 720 Mycobacterium t...
BAA03134     640 GKFLDTNKSPSRKVGELDNR-VVTSILQCIGRNVAAQTTDTELQASFSSVAQALTKQEEKIVAELNAAQGPAIDLNGYYF 718 Colwellia maris
1ITW_A       718 PNTDLTSKAMRPSATFNAALAPLA 741 Azotobacter vinelandii CA6
P16100       718 PNTDLTSKAIRPSATFNAALAPLA 741 Azotobacter vinelandii
P50216       714 PNEEKLTNIMRPVAQFNEIVDALK 737 Corynebacterium glutamicum ATCC 13032
WP_003899797 721 PDSDMTTAVMRPSKTFNAALEAVQ 744 Mycobacterium tuberculosis complex
BAA03134     719 ADTKLAEKAMRPSETFNTILSALL 742 Colwellia maris
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap