1EX2


Conserved Protein Domain Family
maf

?
TIGR00172: maf 
Click on image for an interactive view with Cn3D
MAF protein
This nonessential gene causes inhibition of septation when overexpressed. A member of the family is found in the Archaeon Pyrococcus horikoshii and another in the round worm Caenorhabditis elegans. [Cellular processes, Cell division]
Statistics
?
PSSM-Id: 129276
View PSSM: TIGR00172
Aligned: 7 rows
Threshold Bit Score: 260.408
Threshold Setting Gi: 20140423
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1EX2_A         1 MTKPLILASQSPRRKELLDLLQ--LPYSIIVSEVEE---KLNRNFSPEENVQWLAKQKAKA-VADLHPHAI--------- 65  Bacillus subtil...
Q02169         1 MTKPLILASQSPRRKELLDLLQ--LPYSIIVSEVEE---KLNRNFSPEENVQWLAKQKAKA-VADLHPHAI--------- 65  Bacillus subtil...
P25536         1 MTS-LYLASGSPRRQELLAQLG--VTFERIVTGIEE---QRQPQESAQQYVVRLAREKARAgVAQTAKDLP--------- 65  Escherichia col...
P74331         1 MPPTFVLASASPARKRLLEMAG--ISPLVAVSHFDE---SSLAADNTVALVEALAKAKAGT-VASKFADAL--------- 65  Synechocystis s...
O25838         1 --MELILGSQSSTRANLLKEHG--IKFEQKALYFDE---ESLKTTDPREFVYLACKGKLEK-AKELLANNCa-------- 64  Helicobacter py...
WP_000974788  14 MPK-LILASTSPWRRALLEKLQ--ISFECAAPEVDE---TPRSDESPRQLVLRLAQEKAQS-LASRYPDHL--------- 77  Escherichia coli
Q99210        17 SKYDIILASTSPRRYEILHDIMgiTDLKTMVSTFEEnldKMNYSTDPIGYVCDTSWHKAQN-IIEILTDYEdenpneidk 95  Saccharomyces c...
1EX2_A        66 ---VIGADTMVCLD-GECLGKPQDQEEAASMLRRLSGRS---HSVITAVSIQAEN-----HSETFYDKTEVAFWSLSEE- 132 Bacillus subtil...
Q02169        66 ---VIGADTMVCLD-GECLGKPQDQEEAASMLRRLSGRS---HSVITAVSIQAEN-----HSETFYDKTEVAFWSLSEE- 132 Bacillus subtil...
P25536        66 ---VLGADTIVILN-GEVLEKPRDAEHAAQMLRKLSGQT---HQVMTAVALADSQ-----HILDCLVVTDVTFRTLTDE- 132 Escherichia col...
P74331        66 ---VLGCDSLLLVN-GQTYGKPESPAVAIARWQTMRGQV---GELYTGHALIDRTq---nRCLCQTGLTKVHFADVDDD- 134 Synechocystis s...
O25838        65 ---IVVADSVVSVG-NRMQRKAKNKQEALEFLKRQNGHE---IEVLTCSALISPV-----LEWLDLSVFRARLKAFDPS- 131 Helicobacter py...
WP_000974788  78 ---IIGSDQVCVLD-GEITGKPLTEENARLQLRKASGNI---VTFYTGLALFNSAn---gHLQTEVEPFDVHFRHLSEA- 146 Escherichia coli
Q99210        96 pklIICADTIIIDKsGRIYEKPKTKEVQKKFLMKFCYEDdepVNVVTAVTLIKWYgrenfELVPFRDETKVYFDNKIPLr 175 Saccharomyces c...
1EX2_A       133 EIWTYIETKEPMDKAGAYGIQGRGALFVKKIDG-DYYSVMGLPISKTMRALR 183 Bacillus subtilis subsp. subtilis str. 168
Q02169       133 EIWTYIETKEPMDKAGAYGIQGRGALFVKKIDG-DYYSVMGLPISKTMRALR 183 Bacillus subtilis subsp. subtilis str. 168
P25536       133 DIAGYVASDEPLDKAGAYGIQGLGGCFVRKING-SYHAVVGLPLVETYELLS 183 Escherichia coli K-12
P74331       135 TIQAYVGSGEPLQCAGAFALEGKGGMLINKLDG-CSSNVIGLSLPILRSLLQ 185 Synechocystis sp. PCC 6803 substr. Kazusa
O25838       132 EIEKYLESGLWQESAGCVRLEDFHKPYIKSSSE-NLSVGLGLNVEGLLGALK 182 Helicobacter pylori 26695
WP_000974788 147 EIDNYVRKEHPLHCAGSFKSEGFGITLFERLEGrDPNTLVGLPLIALCQMLR 198 Escherichia coli
Q99210       176 ILEEYVESGDGLEVGGGFKIQGQGAILIEKIEG-DYYNVVGLPLNKTFKGLY 226 Saccharomyces cerevisiae S288c
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap