
Conserved Protein Domain Family

TIGR00172: maf 
Click on image for an interactive view with Cn3D
MAF protein
This nonessential gene causes inhibition of septation when overexpressed. A member of the family is found in the Archaeon Pyrococcus horikoshii and another in the round worm Caenorhabditis elegans. [Cellular processes, Cell division]
PSSM-Id: 129276
Aligned: 7 rows
Threshold Bit Score: 260.408
Threshold Setting Gi: 20140423
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
1EX2_A       133 EIWTYIETKEPMDKAGAYGIQGRGALFVKKIDG-DYYSVMGLPISKTMRALR 183 Bacillus subtilis subsp. subtilis str. 168
Q02169       133 EIWTYIETKEPMDKAGAYGIQGRGALFVKKIDG-DYYSVMGLPISKTMRALR 183 Bacillus subtilis subsp. subtilis str. 168
P74331       135 TIQAYVGSGEPLQCAGAFALEGKGGMLINKLDG-CSSNVIGLSLPILRSLLQ 185 Synechocystis sp. PCC 6803 substr. Kazusa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap