Conserved Protein Domain Family
leuD

?
TIGR00171: leuD 
3-isopropylmalate dehydratase, small subunit
Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures. All are dehydratases (EC 4.2.1.-) and bind a Fe-4S iron-sulfur cluster. 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble the leuC and leuD pair in length and sequence but even more closely resemble the respective domains of homoaconitase, and their identity is uncertain. The candidate archaeal leuD proteins are not included in the seed alignment for this model and score below the trusted cutoff. [Amino acid biosynthesis, Pyruvate family]
Statistics
?
PSSM-Id: 129275
View PSSM: TIGR00171
Aligned: 4 rows
Threshold Bit Score: 346.032
Threshold Setting Gi: 2498516
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P07264 545 MKP-FLTLEGISAPLDKANVDTDAIIPKQFLKTIKRTGLKKGLFYEWRFRkDDQGKDQETDFVLNVEPWREAEILVVTgD 623 Saccharomyces cerevis...
P30126   1 MAEkFIKHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFL-DEKGQQPNPDFVLNFPQYQGASILLAR-E 78  Escherichia coli K-12
P44438   1 MAG-FKQLSGLVVPLDAANVDTDAIIPKQFLQAITRIGFGKHLFHEWRYL-DVEGTKPNPEFVLNYPQYQGATILLAR-K 77  Haemophilus influenza...
P94568   1 MEP-LKSHTGKAAVLNRINVDTDQIIPKQFLKRIERTGYGRFAFFDWRY--DANG-EPNPEFELNQPVYQGASILIAG-E 75  Bacillus subtilis sub...
P07264 624 NFGCGSSREHAPWALKDFGIKSIIAPSYGDIFYNNSFKNGLLPIRLDQQIIIDKLIPIA-NKGGKLCVDLPNQKILDSDg 702 Saccharomyces cerevis...
P30126  79 NFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSFNNQLLPVKLSDAEVDELFALVKaNPGIHFDVDLEAQEVKAGE- 157 Escherichia coli K-12
P44438  78 NLGCGSSREHAPWALADYGFKVMIAPSFADIFYNNSLNNHMLPIRLSEEEVEEIFQWVWaNEGKQIHVDLEAMTVTVGD- 156 Haemophilus influenza...
P94568  76 NFGCGSSREHAPWALDDYGFKIIIAPSFADIFHQNCFKNGMLPIRMPYDNWKQLVGQYE-NQSLQMTVDLENQLIHDSEg 154 Bacillus subtilis sub...
P07264 703 nvLVDHFEIEPFRKHCLVNGLDDIGITLQKEEYI 736 Saccharomyces cerevisiae S288c
P30126 158 --KTYRFTIDAFRRHCMMNGLDSIGLTLQHDDAI 189 Escherichia coli K-12
P44438 157 --KVYTFELDEFRRHCLLNGLDNIGLTLQHEDKI 188 Haemophilus influenzae Rd KW20
P94568 155 --NQISFEVDPHWKEMLINGYDEISLTLLLEDEI 186 Bacillus subtilis subsp. subtilis str. 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap