Conserved Protein Domain Family
leuC

?
TIGR00170: leuC 
3-isopropylmalate dehydratase, large subunit
Members of this family are 3-isopropylmalate dehydratase, large subunit, or the large subunit domain of single-chain forms. Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures. All are dehydratases (EC 4.2.1.-) and bind a Fe-4S iron-sulfur cluster. 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble the leuC and leuD pair in length and sequence but even more closely resemble the respective domains of homoaconitase, and their identity is uncertain. These homologs are now described by a separate model of subfamily (rather than equivalog) homology type, and the priors and cutoffs for this model have been changed to focus this equivalog family more narrowly. [Amino acid biosynthesis, Pyruvate family]
Statistics
?
PSSM-Id: 272940
Aligned: 4 rows
Threshold Bit Score: 916.938
Threshold Setting Gi: 1708801
Created: 7-Oct-2014
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P07264         8 GPRTLYDKVFDAHVVHQDENGSFLLYIDRHLVHEVTSPQAFEGLENAGRKVRRVDCTLATVDHNIPTESRknfksldTFI 87  Saccharomyces c...
P80858         2 MPRTIIEKIWDQHIVKHGEGKPDLLYIDLHLIHEVTSPQAFEGLRQKGRKVRRPQNTFATMDHNIPTVNR-------FEI 74  Bacillus subtil...
WP_001140652   1 MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLRAHGRPVRQPGKTFATMDHNVSTQTKd------INA 74  Enterobacteriaceae
WP_005693329   1 MAKTLYEKLFDSHIVYEAEGETPILYINRHLIHEVTSPQAFDGLRVANRQVRQVNKTFGTMDHSISTQVRd------VNK 74  Haemophilus inf...
P80858         2 MPRTIIEKIWDQHIVKHGEGKPDLLYIDLHLIHEVTSPQAFEGLRQKGRKVRRPQNTFATMDHNIPTVNR-------FEI 74  Bacillus subtil...
WP_001140652   1 MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLRAHGRPVRQPGKTFATMDHNVSTQTKd------INA 74  Enterobacteriaceae
WP_005693329   1 MAKTLYEKLFDSHIVYEAEGETPILYINRHLIHEVTSPQAFDGLRVANRQVRQVNKTFGTMDHSISTQVRd------VNK 74  Haemophilus inf...
P07264        88 KQTDSRLQVKTLENNVKQFGVPYFGMSDARQGIVHTIGPEEGFTLPGTTVVCGDSHTSTHGAFGSLAFGIGTSEVEHVLA 167 Saccharomyces c...
P80858        75 KDEVAKRQVTALERNCEEFGVRLADLHSVDQGIVHVVGPELGLTLPGKTIVCGDSHTSTHGAFGALAFGIGTSEVEHVLS 154 Bacillus subtil...
WP_001140652  75 CGEMARIQMQELIKNCKEFGVELYDLNHPYQGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLA 154 Enterobacteriaceae
WP_005693329  75 LEGQAKIQVLELDKNTKATGIKLFDITTKEQGIVHVMGPEQGLTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLA 154 Haemophilus inf...
P80858        75 KDEVAKRQVTALERNCEEFGVRLADLHSVDQGIVHVVGPELGLTLPGKTIVCGDSHTSTHGAFGALAFGIGTSEVEHVLS 154 Bacillus subtil...
WP_001140652  75 CGEMARIQMQELIKNCKEFGVELYDLNHPYQGIVHVMGPEQGVTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLA 154 Enterobacteriaceae
WP_005693329  75 LEGQAKIQVLELDKNTKATGIKLFDITTKEQGIVHVMGPEQGLTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLA 154 Haemophilus inf...
P07264       168 TQTIIQAKSKNMRITVNGKLSPGITSKDLILYIIGLIGTAGGTGCVIEFAGEAIEALSMEARMSMCNMAIEAGARAGMIK 247 Saccharomyces c...
P80858       155 TQTLWQQRPKTLEVRVDGTLQKGVTAKDVILAVIGKYGVKFGTGYVIEYTGEVFRNMTMDERMTVCNMSIEAGARAGLIA 234 Bacillus subtil...
WP_001140652 155 TQTLKQGRAKTMKIEVQGKAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNMAIEMGAKAGLVA 234 Enterobacteriaceae
WP_005693329 155 TQTLKQARAKSMKIEVRGKVASGITAKDIILAIIGKTTMAGGTGHVVEFCGEAIQDLSMEGRMTVCNMAIEMGAKAGLIA 234 Haemophilus inf...
P80858       155 TQTLWQQRPKTLEVRVDGTLQKGVTAKDVILAVIGKYGVKFGTGYVIEYTGEVFRNMTMDERMTVCNMSIEAGARAGLIA 234 Bacillus subtil...
WP_001140652 155 TQTLKQGRAKTMKIEVQGKAAPGITAKDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNMAIEMGAKAGLVA 234 Enterobacteriaceae
WP_005693329 155 TQTLKQARAKSMKIEVRGKVASGITAKDIILAIIGKTTMAGGTGHVVEFCGEAIQDLSMEGRMTVCNMAIEMGAKAGLIA 234 Haemophilus inf...
P07264       248 PDETTFQYTKGRPLAPKGAEWEKAVAYWKTLKTDEGAKFDHEINIEAVDVIPTITWGTSPQDALPITGSVPDPKNVTDPI 327 Saccharomyces c...
P80858       235 PDEVTFEYCKNRKYTPKGEEFDKAVEEWKALRTDPGAVYDKSIVLDGNKISPMVTWGINPGMVLPVDSEVPAPESFSAED 314 Bacillus subtil...
WP_001140652 235 PDETTFNYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQAEEISPQVTWGTNPGQVISVNDNIPDPASFADPV 314 Enterobacteriaceae
WP_005693329 235 PDETTFAYLKDRPHAPKGKDWEDAVAYWKTLKSDDDAQFDTVVTLEAKDIAPQVTWGTNPGQVISVNETIPNPQEMADPV 314 Haemophilus inf...
P80858       235 PDEVTFEYCKNRKYTPKGEEFDKAVEEWKALRTDPGAVYDKSIVLDGNKISPMVTWGINPGMVLPVDSEVPAPESFSAED 314 Bacillus subtil...
WP_001140652 235 PDETTFNYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQAEEISPQVTWGTNPGQVISVNDNIPDPASFADPV 314 Enterobacteriaceae
WP_005693329 235 PDETTFAYLKDRPHAPKGKDWEDAVAYWKTLKSDDDAQFDTVVTLEAKDIAPQVTWGTNPGQVISVNETIPNPQEMADPV 314 Haemophilus inf...
P07264       328 KKSGMERALAYMGLEPNTPLKSIKVDKVFIGSCTNGRIEDLRSAAAVVRGQKLASNIKlAMVVPGSGLVKKQAEAEGLDK 407 Saccharomyces c...
P80858       315 DKKEAIRAYEYMGLTPHQKIEDIKVEHVFIGSCTNSRMTDLRQAADMIKGKKVADSVR-AIVVPGSQSVKLQAEKEGLDQ 393 Bacillus subtil...
WP_001140652 315 ERASAEKALAYMGLKPGIPLTEVAIDKVFIGSCTNSRIEDLRAAAEIAKGRKVAPGVQ-ALVVPGSGPVKAQAEAEGLDK 393 Enterobacteriaceae
WP_005693329 315 QRASAEKALHYIGLEAGTNLKDIKVDQVFIGSCTNSRIEDLRAAAAVMKGRKKADNVKrILVVPGSGLVKEQAEKEGLDK 394 Haemophilus inf...
P80858       315 DKKEAIRAYEYMGLTPHQKIEDIKVEHVFIGSCTNSRMTDLRQAADMIKGKKVADSVR-AIVVPGSQSVKLQAEKEGLDQ 393 Bacillus subtil...
WP_001140652 315 ERASAEKALAYMGLKPGIPLTEVAIDKVFIGSCTNSRIEDLRAAAEIAKGRKVAPGVQ-ALVVPGSGPVKAQAEAEGLDK 393 Enterobacteriaceae
WP_005693329 315 QRASAEKALHYIGLEAGTNLKDIKVDQVFIGSCTNSRIEDLRAAAAVMKGRKKADNVKrILVVPGSGLVKEQAEKEGLDK 394 Haemophilus inf...
P07264       408 IFQEAGFEWREAGCSICLGMNPDILDAYERCASTSNRNFEGRQGALSRTHLMSPAMAAAAGIAGHFVDIREF 479 Saccharomyces cerevisia...
P80858       394 IFLEAGFEWRESGCSMCLSMNNDVVPEGERCASTSNRNFEGRQGKGARTHLVSPAMAAMAAIHGHFVDVRKF 465 Bacillus subtilis subsp...
WP_001140652 394 IFIEAGFEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGHFADIRNI 465 Enterobacteriaceae
WP_005693329 395 IFIAAGAEWRNPGCSMCLGMNDDRLGEWERCASTSNRNFEGRQGRNGRTHLVSPAMAAAAGVFGKFVDIRDV 466 Haemophilus influenzae
P80858       394 IFLEAGFEWRESGCSMCLSMNNDVVPEGERCASTSNRNFEGRQGKGARTHLVSPAMAAMAAIHGHFVDVRKF 465 Bacillus subtilis subsp...
WP_001140652 394 IFIEAGFEWRLPGCSMCLAMNNDRLNPGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGHFADIRNI 465 Enterobacteriaceae
WP_005693329 395 IFIAAGAEWRNPGCSMCLGMNDDRLGEWERCASTSNRNFEGRQGRNGRTHLVSPAMAAAAGVFGKFVDIRDV 466 Haemophilus influenzae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap