1CM7,1OSJ


Conserved Protein Domain Family
leuB

?
TIGR00169: leuB 
Click on image for an interactive view with Cn3D
3-isopropylmalate dehydrogenase
Several NAD- or NADP-dependent dehydrogenases, including 3-isopropylmalate dehydrogenase, tartrate dehydrogenase, and the dimeric forms of isocitrate dehydrogenase, share a nucleotide binding domain unrelated to that of lactate dehydrogenase and its homologs. These enzymes dehydrogenate their substates at a H-C-OH site adjacent to a H-C-COOH site; the latter carbon, now adjacent to a carbonyl group, readily decarboxylates.Among these decarboxylating dehydrogenases of hydroxyacids, overall sequence homology indicates evolutionary history rather than actual substrate or cofactor specifity, which may be toggled experimentally by replacement of just a few amino acids. 3-isopropylmalate dehydrogenase is an NAD-dependent enzyme and should have a sequence resembling HGSAPDI around residue 340. The subtrate binding loop should include a sequence resembling E[KQR]X(0,1)LLXXR around residue 115. Other contacts of importance are known from crystallography but not detailed here.This model will not find all isopropylmalate dehydrogenases; the enzyme from Sulfolobus sp. strain 7 is more similar to mitochondrial NAD-dependent isocitrate dehydrogenases than to other known isopropylmalate dehydrogenases and was omitted to improve the specificity of the model. It scores below the cutoff and below some enzymes known not to be isopropylmalate dehydrogenase. [Amino acid biosynthesis, Pyruvate family]
Statistics
?
PSSM-Id: 272939
View PSSM: TIGR00169
Aligned: 10 rows
Threshold Bit Score: 571.653
Threshold Setting Gi: 4698
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1CM7_A         6 HIAVLPGDGIGPEVMTQALKVLDAVRN-RFAMRITTSHYDVGGAAIDNHGQPLPPATVEGCEQADAVLFGSVGGPKWEHL 84  Escherichia col...
P24098         2 RVAVLPGDGIGPEVTEAALRVLKALDE-REGLGLTYETFPFGGAAIDGYGEPFPEVTRKGVEAAEAVLLGSVGGPKWDAL 80  Thermus aquaticus
P05645         4 RIALLPGDGIGPEVLESATDVLKSVAE-RFNHEFEFEYGLIGGAAIDEHHNPLPEETVAACKNADAILLGAVGGPKWDQN 82  Bacillus subtil...
O66607         5 KIAVLKGDGIGPEIVEQALRVLDKIGE-IYGVEFEYREGLIGGEAIDKTGDPLPEETLKICKESDAILLGAVGGPKWDNL 83  Aquifex aeolicu...
P73960         6 NVTLLPGDGIGPEIMAVAVAVLGKVAD-QFGFAFNFQEALIGGAAIDATGQPLPEATLAQAKDSDAVLLAAIGGYAWDNL 84  Synechocystis s...
P43860         5 NIAVLAGDGIGPEVMAEAIKVLNRVQE-KFGFKLNFNEFFVGGAAIEHCGYPLPAETLKGCDQADAILFGSVGGPKWTNL 83  Haemophilus inf...
CAA27459       6 KIVVLPGDHVGQEITAEAIKVLKAISDvRSNVKFDFENHLIGGAAIDATGVPLPDEALEASKKVDAVLLGAVGGPKWGTG 85  baker's yeast
WP_001310520   7 HIAVLPGDGIGPEVMTQALKVLDAVRN-RFAMRITTSHYDVGGAAIDNHGQPLPPATVEGCEQADAVLFGSVGGPKWEHL 85  Escherichia coli
P18869         5 KIVVLPGDHIGPEIVASALEVLKVVEKkRPELKLEFEEHKIGGASIDAYGTPLTDETVKACLEADGVLLGAVGGPEWTNP 84  Schizosaccharom...
1OSJ_A         2 KVAVLPGDGIGPEVTEAALKVLRALDE-AEGLGLAYEVFPFGGAAIDAFGEPFPEPTRKGVEEAEAVLLGSVGGPKWDGL 80  Thermus thermop...
1CM7_A        85 ppDQQPER-GaLLPLRKHFKLFSNLRPAKLY-QGLEAFCPLRADIAaNGFDILCVRELTGGIYFGQPKGREGsgq-yeKA 161 Escherichia col...
P24098        81 prKIRPES-G-LLALRKSQDLFANLRPAKVF-PGLERLSPLKEEIA-RGVDVLIVRELTGGIYFGEPRGMSEa-----EA 151 Thermus aquaticus
P05645        83 psELRPEK-G-LLSIRKQLDLFANLRPVKVF-ESLSDASPLKKEYI-DNVDFVIVRELTGGLYFGQPSKRYVntegeqEA 158 Bacillus subtil...
O66607        84 ptDKRPEK-G-LLRIRKELDLYANLRPAKVW-DALISSSPLKEEVV-KGTDMIVIRELTSGIYYGEPRGIFEeng-krYA 158 Aquifex aeolicu...
P73960        85 prSQRPET-G-LLAIREGLGLFANLRPATIF-PQLIDASSLKREVV-EGVDIMVVRELTGGIYFGKPKGIFEtetgekRG 160 Synechocystis s...
P43860        84 ppDQQPERgA-LLPLRKHFKLFCNLRPATLY-KGLEKFCPLRADIAaKGFDMVVVRELTGGIYFGQPKGREGdgv-qtKA 160 Haemophilus inf...
CAA27459      86 --SVRPEQ-G-LLKIRKELQLYANLRPCNFAsDSLLDLSPIKPQFA-KGTDFVVVRELVGGIYFGKRKEDDGd----gVA 156 baker's yeast
WP_001310520  86 ppDQQPERgA-LLPLRKHFKLFSNLRPAKLY-QGLEAFCPLRADIAaNGFDILCVRELTGGIYFGQPKGREGsgq-yeKA 162 Escherichia coli
P18869        85 --NCRPEQ-G-LLKLRKSMGVWANLRPCNFAsKSLVKYSPLKPEIV-EGVDFCVVRELTGGCYFGERTEDNGs----gYA 155 Schizosaccharom...
1OSJ_A        81 prKIRPET-G-LLSLRKSQDLFANLRPAKVF-PGLERLSPLKEEIA-RGVDVLIVRELTGGIYFGEPRGMSEa-----EA 151 Thermus thermop...
1CM7_A       162 FDTEVYHRFEIERIARIAFESARKRRH--KVTSIDKANVLQSSILWREIVNEIAT-EYPDVELAHMYIDNATMQLIKDPS 238 Escherichia col...
P24098       152 WNTERYSKPEVERVAKVAFEAARKRRR--HLTSVDKANVLEVGEFWRKTVEEVHK-GYPDVALDHQYVDAMAMHLVKNPA 228 Thermus aquaticus
P05645       159 VDTLFYKRTEIERVIREGFKMAAARKG--KVTSVDKANVLESSRLWREVAEDVAQ-EFPDVKLEHMLVDNAAMQLIYAPN 235 Bacillus subtil...
O66607       159 INTMKYTEDEIRRIVRKGFEIARKRRK--KLTSVDKANVLEVSALWRQIVEEEKE-NYPDVELEHLYIDNCAMQLVRRPT 235 Aquifex aeolicu...
P73960       161 VNTMAYTVGEIDRIAKVAFETARKRRG--QLCSVDKANVLDVSQLWRDRVMAIAV-DYPDVELSHLYVDNAAMQLVRSPR 237 Synechocystis s...
P43860       161 FDTEVYYKYEIERIARAAFEAAMKRNK--KVTSVDKANVLQSSILWRETVTEMAK-DYPEVTLEHIYIDNATMQLIKSPE 237 Haemophilus inf...
CAA27459     157 WDSEQYTVPEVQRITRMAAFMALQHEPplPIWSLDKANVLASSRLWRKTVEETIKnEFPTLKVQHQLIDSAAMILVKNPT 236 baker's yeast
WP_001310520 163 FDTEVYHRFEIERIARIAFESARKRRH--KVTSIDKANVLQSSILWREIVNEIAT-EYPDVELAHMYIDNATMQLIKDPS 239 Escherichia coli
P18869       156 MDTWPYSLEEVSRIARLAAWLAETSNPpaPVTLLDKANVLATSRLWRKTVAKIFKeEYPHLTLKNQLIDSAAMLLVKSPR 235 Schizosaccharom...
1OSJ_A       152 WNTERYSKPEVERVARVAFELARKRRK--HVVSVDKANVLEVGEFWRKTVEEVGR-GYPDVALEHQYVDAMAMHLVRSPA 228 Thermus thermop...
1CM7_A       239 QFD-VLLCSNLFGDILSDECAMITGSMGMLPSASLNe-------QGFGLYEPAGGSAPDIAGKNIANPIAQILSLALLLR 310 Escherichia col...
P24098       229 RFD-VVVTGNIFGDILSDLASVLPGSLGLLPSASLG--------RGTPVFEPVHGSAPDIAGKGIANPTAAILSAAMMLE 299 Thermus aquaticus
P05645       236 QFD-VVVTENMFGDILSDEASMLTGSLGMLPSASLSs-------SGLHLFEPVHGSAPDIAGKGMANPFAAILSAAMLLR 307 Bacillus subtil...
O66607       236 SFD-VIVTGNIFGDILSDEAGVVVGSLGMLPSASIG--------DRYALYEPVHGSAPDIAGKGIANPIATILSAAMMLK 306 Aquifex aeolicu...
P73960       238 QFD-TIVTGNLFGDILSDIAAMLTGSIGMLPSASLGs-------DGPGLFEPVHGSAPDIAGQDKANPLAQVLSAAMMLR 309 Synechocystis s...
P43860       238 SFD-VLLCSNIFGDIISDEAAMITGSMGMLPSASLNe-------EGFGLYEPAGGSAPDIAGKGIANPIAQILSAAMMLR 309 Haemophilus inf...
CAA27459     237 HLNgIIITSNMFGDIISDEASVIPGSLGLLPSASLAslpd-kntAFGLYEPCHGSAPDLP-KNKVNPIATILSAAMMLKL 314 baker's yeast
WP_001310520 240 QFD-VLLCSNLFGDILSDECAMITGSMGMLPSASLNe-------QGFGLYEPAGGSAPDIAGKNIANPIAQILSLALLLR 311 Escherichia coli
P18869       236 TLNgVVLTDNLFGDIISDEASVIPGSLGLLPSASLSgvvgkseeKVHCLVEPIHGSAPDIAGKGIVNPVGTILSASLLLR 315 Schizosaccharom...
1OSJ_A       229 RFD-VVVTGNIFGDILSDLASVLPGSLGLLPSASLG--------RGTPVFEPVHGSAPDIAGKGIANPTAAILSAAMMLE 299 Thermus thermop...
1CM7_A       311 YSLDADDAACAIERAINRALEE------GIrTGDLARGA-AAVSTDEMGDII 355 Escherichia coli K-12
P24098       300 HAFGLVELARRVEAAVAKALRE------TP-PPDLGGSAgTQAFTEEVLRHL 344 Thermus aquaticus
P05645       308 TSFGLEEEAKAVEDAVNKVLAS------GKrTRDLARSE-EFSSTQAITEEV 352 Bacillus subtilis subsp. subtilis str. 168
O66607       307 YSFNMDKAHDLIEKAIEETLNQ------GYrTPDIYSEGcIKVGTKEITDKI 352 Aquifex aeolicus VF5
P73960       310 YGLDQPQAADRLEDAVKKVLEQ------GYrTGDILSPGtQLVGCRQMGEQL 355 Synechocystis sp. PCC 6803 substr. Kazusa
P43860       310 YSFNLNEAADAIESAVQKVLAS------GHrTADLADDS-TPVSTAEMGTLI 354 Haemophilus influenzae Rd KW20
CAA27459     315 SLNLPEEGKAIEDAVKKVLDAg------IRtGDLGGSNStTEVGDAVAEEVk 360 baker's yeast
WP_001310520 312 YSLDADDAACAIERAINRALEE------GIrTGDLARGA-AAVSTDEMGDII 356 Escherichia coli
P18869       316 YGLNAPKEAEAIEAAVRKVLDDtsiggrGLyTRDLGGEAsTADITKAVVEEL 367 Schizosaccharomyces pombe 972h-
1OSJ_A       300 HAFGLVELARKVEDAVAKALLE------TP-PPDLGGSAgTEAFTATVLRHL 344 Thermus thermophilus HB8
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap