Conserved Protein Domain Family
infC

?
TIGR00168: infC 
translation initiation factor IF-3
infC uses abnormal initiation codons such as AUA, AUC, and CUG which render its expression particularly sensitive to excess of its gene product IF-3 thereby regulating its own expression [Protein synthesis, Translation factors]
Statistics
?
PSSM-Id: 129272
View PSSM: TIGR00168
Aligned: 8 rows
Threshold Bit Score: 201.088
Threshold Setting Gi: 2497283
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P72874        14 INERIRFPEIRVIDSDGaQLGIITPNEAMEIADERGLDLVLVSETADPPVCRIMDYGKYKFEQEKKAREAKKKQHTADVK 93  Synechocystis s...
O51208        22 INYRIKAREVRVIFENG-TQEVLSIEDAIKKAKEAGLDLVEVSPNVSPPVCKIIDYGKYKFHQEKRQKEQKKNQKVIKLK 100 Borrelia burgdo...
P55973         8 LNGDINFKEVRCVGDNGeVYGIISSKEALHIAQNLGLDLVLISASAKPPVCKVMDYNKFRYQNEKKIKEAKKKQKQIEIK 87  Helicobacter py...
P78024        37 INDKIGFNEFILIDENGsNLGTVRRTDALKMAEEKQLDLVLIGSNPAKPIVKLLDFGRYTYDLKRKKRQSKKNQTIIQIK 116 Mycoplasma pneu...
WP_003222413   2 VNEGIRAREVRLIGQNGdQLGIKSRQEALEIAGRANLDLVLVAANAKPPVCRIMDYGKFRFEQQKKEKEARKNQKIINLK 81  Bacillales
WP_001700733  15 INGEIRAQEVRLTGLEGeQLGIVSLREALEKAEEAGVDLVEISPNAEPPVCRIMDYGKFLYEKSKSSKEQKKKQKVIQVK 94  Enterobacteriaceae
WP_009885737  17 VNEQIAFNQFTLIDENStNLGIVKMENALKLAQEKQLDLVLIAPNPTKPIVKLLDFGRYTYDLKRKKRQAKKNQTIIQTK 96  Mycoplasma geni...
WP_010869182  16 INEEIRVKEVRLIDQNGeQAGIVSIQQALEMAEQAELDLVEISPNAEPPVCRIMNYGKFLYEKSKTAKEQKKKQKVVQVK 95  Haemophilus inf...
P72874        94 EVKMRYKIDEHDYQVRINQAKRFLKAGDKVKATVNFRGREIQHAHLAKELLDRMATDLATEADIQQAP-KREGRNMMMFL 172 Synechocystis s...
O51208       101 EVRMQPKIDAHDLDFKSKNILGFLKDGNKVKVTIRFRGRELAHTYLGYGILNSILEKVGDVNYVLESAaKMEGKTMFLIV 180 Borrelia burgdo...
P55973        88 EIKLSTQIAQNDINYKVKHAREFIESNKHVKFKVVLKGRESQNSKAGLDVLFRVQTMMQDLANPEKEP-KTEGRFVSWMF 166 Helicobacter py...
P78024       117 EVVVKPTIAKHDLEFKAKQTTGWAEKGYHVKFVVRAFGRVSTRIELIEKVFNDFYLLVEPAVEVQKPLtASSKTMYSALL 196 Mycoplasma pneu...
WP_003222413  82 EVRLSPTIDEHDFNTKLRNAIKFLEKGDKVKASIRFKGRAITHKEIGQRVLDRFSEACAEVATVETKP-KMDGRSMFLML 160 Bacillales
WP_001700733  95 EIKFRPGTDEGDYQVKLRSLIRFLEEGDKAKITLRFRGREMAHQQIGMEVLNRVKDDLQELAVVESFPtKIEGRQMIMVL 174 Enterobacteriaceae
WP_009885737  97 EVVVKPTIAKHDLEFRAKQSKNWIEKGHHVKFIVRAFGRVSTRIELIEKVFDDFYQLVKDVVEIQKPLtASSKTMYAALL 176 Mycoplasma geni...
WP_010869182  96 EIKFRPGTDEGDYQVKLRSLIRFLEDGDKAKITVRFRGREMAHQDIGLDVLERVKNDLAEISVVESAPgKLEGRQAVMVL 175 Haemophilus inf...
P72874       173 SPKKV 177 Synechocystis sp. PCC 6803 substr. Kazusa
O51208       181 APKFK 185 Borrelia burgdorferi B31
P55973       167 VPKAK 171 Helicobacter pylori 26695
P78024       197 VPRKK 201 Mycoplasma pneumoniae M129
WP_003222413 161 APKNE 165 Bacillales
WP_001700733 175 APKKK 179 Enterobacteriaceae
WP_009885737 177 VPLKR 181 Mycoplasma genitalium
WP_010869182 176 APKKK 180 Haemophilus influenzae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap