Conserved Protein Domain Family
PS_decarb_rel

?
TIGR00164: PS_decarb_rel 
phosphatidylserine decarboxylase precursor-related protein
Phosphatidylserine decarboxylase is synthesized as a single chain precursor. Generation of the pyruvoyl active site from a Ser is coupled to cleavage of a Gly-Ser bond between the larger (beta) and smaller (alpha chains). It is an integral membrane protein. This protein has many regions of homology to known phosphatidylserine decarboxylases, including the Gly-Ser motif for chain cleavage and active site generation, but has a shorter amino end and a number of deletions along the length of the alignment to the phosphatidylserine decarboxylases. It is unclear whether this protein is a form of phosphatidylserine decarboxylase or is a related enzyme. It is found in Neisseria gonorrhoeae, Mycobacterium tuberculosis, and several archaeal species, all of which lack known phosphatidylserine decarboxylase. [Unknown function, General]
Statistics
?
PSSM-Id: 129268
View PSSM: TIGR00164
Aligned: 4 rows
Threshold Bit Score: 262.431
Threshold Setting Gi: 499181997
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58227         1 MGKYKKFFAIAVCSLLLFTVYFYRDPDRVITKGNNIILSPADGTve--yIKFYENgnpevfkdgncyvlnVSRYFPNG-C 77  Methanocaldococ...
AAA84884      28 VSMCCGWWSLPFWVFTVFALQFFRDPAREIPQNPEAVLSPVDGR-----IVVVER---------------ARDPYRDVdA 87  Neisseria gonor...
WP_010876657  18 LFGYH-AIGILMFTVIAFMMQFFRDPDRIPPSDEDLIIAPADGRrlsgkIDRIERvgsd--------yplIDRIFPDGsG 88  Methanothermoba...
WP_010879537  20 AYLLHPLISALFVGFALFTAYFFRDPERKIGEG---VVSPADGR-----IDYLE-------------------------G 66  Archaeoglobus f...
Q58227        78 -YVVGIFMSPLDVHVNRAPIGGRIVYIKHIDGSFYPAFLEGVEKINERNIVIIKNGSE-YVGVVQIAGFVARRCWLSIKE 155 Methanocaldococ...
AAA84884      88 -LKISIFMNVFNVHSQKSPADCTVTKVVYNKGKFVNADLDKASTENERNAVLATTASGrEITFVQVAGLVARRILCYTQA 166 Neisseria gonor...
WP_010876657  89 gILISTFMSPFDVHVNRAPVSGKVIYTEHVDGRFQVARSRVL-TENEKNLIVIKTDYG-NVGVIQIAGFVARRIVQYVKE 166 Methanothermoba...
WP_010879537  67 -RRLEIFMSPFDCHINRAPWGGKVLSVKFIEGSTPPAFIRKSG-VRTNE-ILIETEHG-VFRVLQMAGIFARRIVSYVSE 142 Archaeoglobus f...
Q58227       156 GECINMGQKIGMIKLGSQTAVIIPANYNITVKVGERVYAGQTIIAVKRTDN 206 Methanocaldococcus jannaschii DSM 2661
AAA84884     167 GAKLSRGERYGFIRFGSRVDMYLPVDAQAQVAIGDKVTGVKTVLARLPLTD 217 Neisseria gonorrhoeae
WP_010876657 167 GEYVERGDRIGMIRFGSRVDLVLPENCEVLVKTGSRPMAGETVVARFNPGK 217 Methanothermobacter thermautotrophicus
WP_010879537 143 GDVVKKGQKIGMIRFGSRVVLEVPEGFRFVRGVGEKVKAGETVALRDESFQ 193 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap