Conserved Protein Domain Family
TIGR00162

?
TIGR00162: TIGR00162 
TIGR00162 family protein
This model represents one out of two closely related ortholgous sets of proteins that, so far, are found only in but are universal among the Archaea. This ortholog set includes MJ1210 from Methanococcus jannaschii and AF0525 from Archaeoglobus fulgidus while excluding MJ0106 and AF1251. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129266
View PSSM: TIGR00162
Aligned: 3 rows
Threshold Bit Score: 277.492
Threshold Setting Gi: 499180492
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58607        73 MCAEFYAIREP----KPMIVVLGNTQALSPIGQYHLAEEIVKIGIEYGANFVYTLGGFGVGKLCEEVKVYGATTSKELAK 148 Methanocaldococ...
WP_010876919   1 MRNEFYYLRDAggdeRDYIILVGNTQGLSPEGQYEICGMILDFVEGYGARRIFTLGGLATGQPVEKARVYGAATSMELVE 80  Methanothermoba...
WP_010878032  73 PKNEVYAWKSDgn-gTDLLILVGDFQSISNEGHFELVNAYIDVAKKFSARMIYTLGGYGVGKLVEEPYVIGAANSPEIVE 151 Archaeoglobus f...
Q58607       149 KLKEHDILF--RTDGGGIVGAAGLMLMFADLNGIPGICLMGETPGYLIDPNAAKAVLEKFCKLENIEINMEELEKRAKGM 226 Methanocaldococ...
WP_010876919  81 DLKEHGVIM--RSADGGIIGASGLLLGMGRLRGMDGVCLMGETPGYFIDAEAARALLEVLLEMTKLEVDLEKLEERAEET 158 Methanothermoba...
WP_010878032 152 ELKSYGVKFepGEPGGGIIGASGLLLGVSELEGIPAACLMGVTSGYMVDPKSAKVVLDVLCKMLSLEVSVEALEERAKEM 231 Archaeoglobus f...
Q58607       227 EQFIEKIKKFEEEMLKAAQAKPpSEEDLRYIG 258 Methanocaldococcus jannaschii DSM 2661
WP_010876919 159 KKMISKAQQMEQEMIERMNLKP-GEEDLRYIG 189 Methanothermobacter thermautotrophicus
WP_010878032 232 EKIIAQIKEMQEMAVQQWK----SDEDLRYFR 259 Archaeoglobus fulgidus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap