Conserved Protein Domain Family
TIGR00161

?
TIGR00161: TIGR00161 
TIGR00161 family protein
This model represents one out of two closely related ortholgous sets of proteins that, so far, are found only in the Archaea. This ortholog set includes MJ0106 from Methanococcus jannaschii and AF1251 from Archaeoglobus fulgidus, but not MJ1210 or AF0525. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129265
View PSSM: TIGR00161
Aligned: 3 rows
Threshold Bit Score: 364.938
Threshold Setting Gi: 2495801
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q57570         2 VDSMKFV-EKAKIEFENPIVIEAFPGTGLVGSIAGFQIIKDLNLKYFGYFEVDGILPLTTIEKGIPYPPVRAYANKDF-- 78  Methanocaldococ...
WP_010878746   1 MELETEI-IVDKVDVENPILITSFPGIGLVGTIATAHYIMELKLESIGIVDSRLLPPVASLYEGVILPPVRVYQSADLgf 79  Archaeoglobus f...
WP_010876917   3 IKTETECcTIYSEDVEDAVVLEGSPGVGLIGNILGWLLVEDLKMREIGYIDSKYFPPLAVLYKGVAIHPFRIYEG-DGi- 80  Methanothermoba...
Q57570        79 IILFSDIIISPFKINGLAEFIVKTFSNKNPKLFVSLGGIMAGK-SEKVFGIANKEELIEDLKNY-VEIFDFGVVGGMGGN 156 Methanocaldococ...
WP_010878746  80 VLIHSDVPIIPQAAIDMSKKIVQFAAEINARRVYSFAGVATFEdKKRVFAAATSKELLEEVKDH-AEIFKTGTISGIAGS 158 Archaeoglobus f...
WP_010876917  81 VLFLSDFILPPAVVYDMTNAIVEWMVRNKSRELITFNSMVVREkSQPVAGAGNSQEVIQRLADLgIPIVPFGNLNGISGT 160 Methanothermoba...
Q57570       157 LLIKCHDNGFDAIGLLAETVGIRPDPRGGANLLEVLNKMFNLNVNIENLIKEAEAIENKLKELAEQHLKMMSKsRKEYPM 236 Methanocaldococ...
WP_010878746 159 IMNECVAAKMPGIVLLGETLGFNPDPRAAASLIEAVNKIMNWNVSVEKLLKEAEMIEAQMQKLAEQARMQEER-KEEFPM 237 Archaeoglobus f...
WP_010876917 161 LLTRCAVNDIPASCLFAEILNPYPDPRAAASVVEVLNEMLGTSVDPEPLLQEAQAIESRLKKLAETVQG-----EAETPI 235 Methanothermoba...
Q57570       237 YI 238 Methanocaldococcus jannaschii DSM 2661
WP_010878746 238 YG 239 Archaeoglobus fulgidus
WP_010876917 236 YM 237 Methanothermobacter thermautotrophicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap