Conserved Protein Domain Family
TIGR00159

?
TIGR00159: TIGR00159 
TIGR00159 family protein
These proteins have no detectable global or local homology to any protein of known function. Members are restricted to the bacteria and found broadly in lineages other than the Proteobacteria. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129263
View PSSM: TIGR00159
Aligned: 5 rows
Threshold Bit Score: 265.524
Threshold Setting Gi: 2496300
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P47351         1 MVVNILLFITLIFLLLLFVFLI----------AFAFLNKRVRNYVVR----TWTSVFSk-SKQNLDKKNFFDNLTSTLLR 65  Mycoplasma geni...
P75528         2 MTVEVFSVIILVLLFLILALTL----------LFVLLNKRTRSFVIR----TFTGLFR--SKHTTSQKNFYDNLTSTLLR 65  Mycoplasma pneu...
WP_003223651  45 VVIVLVRMASQYLGLSTLQWLMdqaitwgflaIIIIFQPELRRALEQl--gRGRFFSRsgTPVEEAQQKTIEAITKAINY 122 Bacillales
WP_010874054  48 LVLMVAQLVSDRLHLELLKFVLekfvlgtavaLAVIFQAELRRFLELlgqgRFLELLRr-RSSSPPSTDAIDEIVDAVKE 126 Synechocystis s...
WP_002656665  47 LIIISVGIISYYLNLYTISWLLnyianilpiaIVILFNQEIKKIIMQi--gNFNLAFKl-SNKKEETLKVISEILKAVKH 123 Borrelia burgdo...
P47351        66 LSVDKIGAIIAIEKRDSLEP--YINIGYRVSSDFSPELLVTIFYNkSSPLHDGAVIVRDYKIISVSSYFPMT-R-QLIDV 141 Mycoplasma geni...
P75528        66 LSTDKIGAIIAIENQDSLES--YVNIGYRVTSDFSPELLVTIFYNkQSPLHDGAVIVRDYQIVSVSSYFPMT-R-QLIDV 141 Mycoplasma pneu...
WP_003223651 123 MAKRRIGALLTIERDTGMGD--YIETGIPLNAKVSSELLINIFIP-NTPLHDGAVIMKNNEIAAAACYLPLS-EsPFISK 198 Bacillales
WP_010874054 127 LSQNRIGALMVMEAQGILDSriFLNRGVAIDSKLSKELLQTIFQP-KTLLHDGAIFIRGSRLVAAGVILPLS-E-RSASR 203 Synechocystis s...
WP_002656665 124 LSENKSGSLICIEKKIQLEQ--IINKGTKIDALISSELLISLFER-ETPLHDGAVIISKNKLKYAGSFLPLSnV-DSISK 199 Borrelia burgdo...
P47351       142 SYGSRHRSALGLSEKSD-AVVFIVSETTGKISVALKGVIKTLSSNSDRLQDEIIHYLSSK 200 Mycoplasma genitalium G37
P75528       142 SYGSRHRSALGLTEKCD-AIVFIVSETTGKISVAVRGVIKTLSSNSDRLQDQIIHYLTVK 200 Mycoplasma pneumoniae M129
WP_003223651 199 ELGTRHRAAVGISEVTD-SLTIIVSEETGGVSVAKNGDLHRELTEEALKEMLEAEFKKNT 257 Bacillales
WP_010874054 204 QLGTRHRAAMGITEKSEnCLCIVVSEETGSITLAQGGNLNRPLTSSKLKELLETEYAPPT 263 Synechocystis sp. PCC 6803
WP_002656665 200 AFGTRHRAGLGISENSD-AITIITSEETGSISITINAKLEYNLSLSEIRNKLNLELIE-- 256 Borrelia burgdorferi group
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap