Conserved Protein Domain Family
TIGR00156

?
TIGR00156: TIGR00156 
TIGR00156 family protein
As of the last revision, this family consists only of two proteins from Escherichia coli and one from the related species Haemophilus influenzae. [Hypothetical proteins, Conserved]
Statistics
?
PSSM-Id: 129260
View PSSM: TIGR00156
Aligned: 3 rows
Threshold Bit Score: 178.957
Threshold Setting Gi: 1176141
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P31130   1 MKFQAIVLASFLVMPYALADDQGGLKqdaAPPPPHAIEDGYRGTDdAKKMTVDFAKTMHDGASVSLRGNLISHKGEDRYV 80  Escherichia coli K-12
P52083   2 KKFAAVIAVMALCSAPVMAAEQGGFS---GPSATQSQAGGFQGPN-GSVTTVESAKSLRDDTWVTLRGNIVERISDDLYV 77  Escherichia coli
P44293   1 MKKFALATIFALATTSAFAGFNGNNS-----------QGGFQQAA-PAAISVKQALSAADNSMITLVGNITQQIDDDEFW 68  Haemophilus influenza...
P31130  81 FRDKSGEINVVIPAAVFDGREVQPDQMINISGSLD-KKSAPAVVRVTHLQK 130 Escherichia coli K-12
P52083  78 FKDASGTINVDIDHKRWNGVTVTPKDTVEIQGEVD-KDWNSVEIDVKQIRK 127 Escherichia coli
P44293  69 FTDGTGQIKIEIKKRVWNGLNVDSKDKVKIYGKLDnEVFEKAELDVLRIEK 119 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap