Conserved Protein Domain Family

TIGR00149: TIGR00149_YjbQ 
secondary thiamine-phosphate synthase enzyme
Members of this protein family have been studied extensively by crystallography. Members from several different species have been shown to have sufficient thiamin phosphate synthase activity (EC to complement thiE mutants. However, it is presumed that this is a secondary activity, and the primary function of this enzyme remains unknown. [Unknown function, Enzymes of unknown specificity]
PSSM-Id: 129253
Aligned: 6 rows
Threshold Bit Score: 202.681
Threshold Setting Gi: 3123134
Created: 7-Oct-2014
Updated: 25-Oct-2021
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
Format: Row Display: Color Bits: Type Selection:
O05243  79 MEGNTAAHMKSSTVGASQHVIVENGRLILGTWQGIYFCEFDGPRTRT-CYIKMMG- 132 Bacillus subtilis subsp. subtilis str. 168
O26865  88 IDNNADSHLRAVLLGGSQTVPVINGSMDLGTWQSIFFAELDGPRNRR-IRVSVAGK 142 Methanothermobacter thermautotrophicus str. D...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap