Conserved Protein Domain Family
TIGR00149_YjbQ

?
TIGR00149: TIGR00149_YjbQ 
secondary thiamine-phosphate synthase enzyme
Members of this protein family have been studied extensively by crystallography. Members from several different species have been shown to have sufficient thiamin phosphate synthase activity (EC 2.5.1.3) to complement thiE mutants. However, it is presumed that this is a secondary activity, and the primary function of this enzyme remains unknown. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 129253
View PSSM: TIGR00149
Aligned: 6 rows
Threshold Bit Score: 202.681
Threshold Setting Gi: 3123134
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P32698   4 QKTLTLSAKSRGFHLVTDEILNQLADMpRVNIGLLHLLLQHTSASLTLNENCDPTVRHDMERFFLRTVPDNGNYEHDy-E 82  Escherichia coli
P74125  12 QEILVIATQGKSLHNFNSKIQAVVQHS-GVKTGLCTVFVRHTSASLIIQENADPDVLTDLAIFFAQLVPEDGRRYRHstE 90  Synechocystis sp. PCC...
Q58481   8 FKYQIKTNKREELVDITPYIISAISES-KVKDGIAVIYVPHTTAGITINENADPSVKHDIINFLSHLIPKNWNFT----H 82  Methanocaldococcus ja...
O05243   3 KTLQIKTTKRDEMIDITREVEAFLQET-GITSGAALIYCPHTTAGITINENADPDVKKDMLRRFDEVYPWEHELDR---H 78  Bacillus subtilis sub...
O28229   1 MELTLKTAKRVEIIDITDQVERCVES----RDGLVLVYTPHTTTALVINEGER-GLLEDILEFMEKLVPYGKGYKHD--R 73  Archaeoglobus fulgidu...
O26865  12 QELPLRTSRRVELIDITSMVSGVLESS-GIRNGILNVFSRHSTSAIFINENES-RLLSDIESMLEGTVPVDASYGHN--A 87  Methanothermobacter t...
P32698  83 GADDMPSHIKSSMLGTSLVLPVHKGRIQTGTWQGIWLGEHRIHGGSRrIIATLQGE 138 Escherichia coli
P74125  91 GLDDMPAHIRSALTKTSEHIPIVNGRLGLGTWQGVFLWEHRQRPHQReVIVHVSGE 146 Synechocystis sp. PCC 6803 substr. Kazusa
Q58481  83 LEGNSDAHIKSSLVGCSQTIIIKDGKPLLGTWQGIFFAEFDGPRRRE-FYVKIIGD 137 Methanocaldococcus jannaschii DSM 2661
O05243  79 MEGNTAAHMKSSTVGASQHVIVENGRLILGTWQGIYFCEFDGPRTRT-CYIKMMG- 132 Bacillus subtilis subsp. subtilis str. 168
O28229  74 LDSNADAHLKATLLGNSVVVPVESGKLALGTWQRILFLEFDGPRTRR-VIVKAL-- 126 Archaeoglobus fulgidus DSM 4304
O26865  88 IDNNADSHLRAVLLGGSQTVPVINGSMDLGTWQSIFFAELDGPRNRR-IRVSVAGK 142 Methanothermobacter thermautotrophicus str. D...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap