2IDB


Conserved Protein Domain Family
TIGR00148

?
TIGR00148: TIGR00148 
Click on image for an interactive view with Cn3D
UbiD family decarboxylase
The member of this family in E. coli is UbiD, 3-octaprenyl-4-hydroxybenzoate carboxy-lyase. The family described by this model, however, is broad enough that it is likely to contain several different decarboxylases. Found in bacteria, archaea, and yeast, with two members in A. fulgidus. No homologs were detected besides those classified as orthologs. The member from H. pylori has a C-terminal extension of just over 100 residues that is shared in part by the Aquifex aeolicus homolog. [Unknown function, General]
Statistics
?
PSSM-Id: 129252
View PSSM: TIGR00148
Aligned: 10 rows
Threshold Bit Score: 441.434
Threshold Setting Gi: 6686190
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2IDB_A   9 LRDFLTLLEQQGELKRITLPVDPHLEITEIADRTLR--AGGPALLFENP--------KGYSXPVLCNLFGTPKRVAXGXG 78  Escherichia coli K-12
P72861   5 LRGFIQLLETRGQLRRITAEVDPDLEVAEISNRMLQ--AGGPGLLFENV--------KGSPFPVAVNLMGTVERICWAMN 74  Synechocystis sp. PCC...
O30030   6 LREFIGRLEDKGELARVKHEVSPILEMSEVADRTVK--AGGKALLFERP--------KGYDIPVFMNAFGTERRMKLALE 75  Archaeoglobus fulgidu...
O25157   1 MRDFLKLLKKHDELKIIDTPLEVDLEIAHLAYIEAKkpNGGKALLFTQPirkehdqiKTFGMPVLMNAFGSFKRLDLLLK 80  Helicobacter pylori 2...
P94405   6 FREFLAALEKEGQLLTVNEEVKPEPDLGASARAASNlgDKSPALLFNNIy-------GYHNARIAMNVIGSWPNHAMMLG 78  Bacillus subtilis sub...
P41655   1 MRNFLDKIG--EEALVVEDEVSTSFEAASILREHPR-----DLVILKNL--------KESDIPVISGLCNTREKIALSLN 65  Methanothermobacter t...
Q58533   1 MREIINKLN-----PIIIDKADKKFGVSRILKKYDG-----KPVYIKDV----------NGFEVVGNLC-SRETLSKIFN 59  Methanocaldococcus ja...
O28630   6 QKNFICLKRTFSMNLRDAISVANPVQLEEEIKHDEVvsFLKSKNLLDKPvi-----lNVEGKKVAKNFVSSRETLGKYLG 80  Archaeoglobus fulgidu...
Q03034  10 FRDFIQVLKDEDDLIEITEEIDPNLEVGAIMRKAYE--SHLPAPLFKNL---------KGASKDLFSILGCPAGLRSKEK 78  Saccharomyces cerevis...
P26615   9 LRDFLTLLEQQGELKRITLPVDPHLEITEIADRTLR--AGGPALLFENP--------KGYSMPVLCNLFGTPKRVAMGMG 78  Escherichia coli
2IDB_A  79 QEdvsalrevGKLLAFLKEPEPP-KgFRDLFDKLPQFKQVLNXPT--KRLRGAPCQQKIVSGDDVDLNRIPIXTCWPEDA 155 Escherichia coli K-12
P72861  75 MDhpleledlGKKLALLQQPKPPkK-ISQAIDFGKVLFDVLKAKP--GRNFFPPCQEVVIDGENLDLNQIPLIRPYPGDA 151 Synechocystis sp. PCC...
O30030  76 VErle---eiGERLLSALEFRPS-S-FMDALKGVGMLKDFMSFIP--KKTGKAPCKEVVAES----LDKFPILKCWPKDA 144 Archaeoglobus fulgidu...
O25157  81 TPie----slQQRMQAFLHFNAPkN-FTEGLKVLKDLWDLRHIFP--KKTTR-PKDLIIKQDKEVNLLDLPVLKTWEKDG 152 Helicobacter pylori 2...
P94405  79 MP---------K--------DTP---VKEQFFEFAKRYDQFPMPV--KREETAPFHENEITEDINLFDILPLFRINQGDG 136 Bacillus subtilis sub...
P41655  66 CR---------------------------VHEITHRIVEAMENPT--PISSVGGLDGYRSGR--ADLSELPILRHYRRDG 114 Methanothermobacter t...
Q58533  60 VK---------------------------KEDFIFFMLDAMEKEKegKLKINNKLKEKYIVEIPENIKNWPIPIYYEKDA 112 Methanocaldococcus ja...
O28630  81 VD----------------------------AYSIARELSKIEDRE--AEIRVEPFSSLAMKKVDVNLQELPVIKYFPRDG 130 Archaeoglobus fulgidu...
Q03034  79 GD--------HGRIAHHLGLDPKtT-IKEIIDYLLECKEKEPLPPitVPVSSAPCKTHILSEEKIHLQSLPTPYLHVSDG 149 Saccharomyces cerevis...
P26615  79 QEdvsalrevGKLLAFLKEPEPPkG-FRDLFDKLPQFKQVLNMPT--KRLRGAPCQQKIVSGDDVDLNRIPIMTCWPEDA 155 Escherichia coli
2IDB_A 156 A-PLITWGLTVTRGPHK----ERQNLGIYRQQLIGKNKLIXRWLSHRGGALDYQEwcAAHPGERFPVSVALGADPATILG 230 Escherichia coli K-12
P72861 152 G-KIITLGLVITKDCET----GTPNVGVYRLQLQSKTTMTVHWLSVRGGARHLRK--AAEQGKKLEVAIALGVDPLIIMA 224 Synechocystis sp. PCC...
O30030 145 G-RFITFPVVITKDPET----GEMNAGMYRMQVFDGKTTGMHWQIHKHGAEHFRKm-AEKGGGKIEVAVAIGVDPATLYA 218 Archaeoglobus fulgidu...
O25157 153 G-AFITMGQVYTQSLDH----QKKNLGMYRLQVYDKNHLGLHWQIHKDSQLFFHE--YAKAKVKMPVSIAIGGDLLYTWC 225 Helicobacter pylori 2...
P94405 137 G-YYLDKACVISRDLEDpdnfGKQNVGIYRMQVKGKDRLGIQPVPQHDIAIHLRQ--AEERGINLPVTIALGCEPVITTA 213 Bacillus subtilis sub...
P41655 115 G-PYITAGVIFARDPDT----GVRNASIHRMMVIGDDRLAVR-IVPRHLYTYLQK--AEERGEDLEIAIAIGMDPATLLA 186 Methanothermobacter t...
Q58533 113 G-AYITSGVVVVYDKDY----G-YNLSIHRILVK-DDYLVIRMVEQRHLHFLYNK--ALKEKGYLDVAIVIGVHPAVLLA 183 Methanocaldococcus ja...
O28630 131 G-RYITAGIVIAQR-N-----GVYNASIHRMLLLDESRVAARLVPPRHTYLMWRE--AVEREEELEVAVVIGTHPLFLFA 201 Archaeoglobus fulgidu...
Q03034 150 GkYLQTYGMWILQTPDK----KWTNWSIARGMVVDDKHITGLVIKPQHIRQIADSwaAIGKANEIPFALCFGVPPAAILV 225 Saccharomyces cerevis...
P26615 156 A-PLITWGLTVTRGPHK----ERQNLGIYRQQLIGKNKLIMRWLSHRGGALDYQEwcAAHPGERFPVSVALGADPATILG 230 Escherichia coli
2IDB_A 231 AVTPVPDTLSEYAFAGLLRGTKTEVVKCISNDLEVPASAEIVLEGYIEQGETAPEGPYGDHTGYYNEVD--SFPVFTVTH 308 Escherichia coli K-12
P72861 225 AATPIPVDLSEWLFAGLYGGSGVALAKCKTVDLEVPADSEFVLEGTITPGEMLPDGPFGDHMGYYGGVE--DSPLVRFQC 302 Synechocystis sp. PCC...
O30030 219 ATAPLPSGISEFMFAGFIRKERLKVTECETVDLLVPANAEIILEGYVRVDEMRVEGPFGDHTGYYTPPE--PYPVFHITH 296 Archaeoglobus fulgidu...
O25157 226 ATAPLPYGIYELMLYGFMRGKKARVMPCLSNSLSVPSDCDIVIEGFVDCEKLELEGPFGDHTGYYTPIE--PYPVLEVKT 303 Helicobacter pylori 2...
P94405 214 ASTPLLYDQSEYEMAGAIQGEPYRIVKSKLSDLDVPWGAEVVLEGEIIAGEREYEGPFGEFTGHYSGGR--SMPIIKIKR 291 Bacillus subtilis sub...
P41655 187 TTTSIPIDADEMEVANTFHEGELELVRCEGVDMEVPP-AEIILEGRILCGVREREGPFVDLTDTYDVVR--DEPVISLER 263 Methanothermobacter t...
Q58533 184 GSTSADITFDELKFAAALLGGEIGVFELD-NGLLVPE-AEFIIEGKILP-EVDDEGPFVDITGTYDIVR--KQPIIKIEK 258 Methanocaldococcus ja...
O28630 202 SATRVPSG-KEFSYAAGLMG-RLTLYRKG--EMLVPD-SEIILFGRITA-ETAKEGPFVDITGTYDIVR--DEPVIVFDE 273 Archaeoglobus fulgidu...
Q03034 226 SSMPIPEGVSESDYVGAILGESVPVVKCETNDLMVPATSEMVFEGTLSLTDTHLEGPFGEMHGYVFKSQghPCPLYTVKA 305 Saccharomyces cerevis...
P26615 231 AVTPVPDTLSEYAFAGLLRGTKTEVVKCISNDLEVPASAEIVLEGYIEQGETAPEGPYGDHTGYYNEVD--SFPVFTVTH 308 Escherichia coli
2IDB_A 309 ITQREDAIYHSTYTGRPPDE-PAVLGVALNEVFVPILQKQFPEIVDFYLP-PEGCSYRLAVVTIK-----KQYAGHAKRV 381 Escherichia coli K-12
P72861 303 LTHRKNPVYLTTFSGRPPKE-EAMMAIALNRIYTPILRQQVSEITDFFLP-MEALSYKAAIISID-----KAYPGQAKRA 375 Synechocystis sp. PCC...
O30030 297 ITHRENPIYHATVVGKPPME-DAWLGKATERIFLPILRMMHPEIVDINLP-VEGAFHNLAIVSIK-----KRYPGQAKKV 369 Archaeoglobus fulgidu...
O25157 304 ISYKKDSIYLATVVGKPPLE-DKYMGYLTERLFLPLLQMNAPNLIEYYMP-ENGVFHNLILAKIH-----TRYNAHAKQV 376 Helicobacter pylori 2...
P94405 292 VYHRNNPIFEHLYLGMPWTEcDYMIGINTCVPLYQQLKEAYPNEIVAVN--AMYTHGLIAIVSTK-----TRYGGFAKAV 364 Bacillus subtilis sub...
P41655 264 MHIRKDAMYHAILPAGFEHR--LLQGLPQEPRIYRAVKNTVPTVRNVVLT-EGGCCWLHAAVSIK-----KQTEGDGKNV 335 Methanothermobacter t...
Q58533 259 LYRKEKPIFHALLPGGIEHK--TLMGMPQEPRILKGVRNTVPTVKNIVLT-EGGCCWLHAVVQIE-----KRTEGDGKNA 330 Methanocaldococcus ja...
O28630 274 MYVKEDYIYYSITPAGKEHQ--MLMGVPYEPVIYRFVSN-VCKVKNVITT-PGSCHYFHCVVQIE-----KKSEGDGKNA 344 Archaeoglobus fulgidu...
Q03034 306 MSYRDNAILPVSNPGLCTDEtHTLIGSLVATEAKELAIESGLPILDAFMPyEAQALWLILKVDLKglqalKTTPEEFCKK 385 Saccharomyces cerevis...
P26615 309 ITQREDAIYHSTYTGRPPDE-PAVLGVALNEVFVPILQKQFPEIVDFYLP-PEGCSYRLAVVTIK-----KQYAGHAKRV 381 Escherichia coli
2IDB_A 382 XXGVWSFLrQFXYTKFVIVCDDDV-NARDWNDVIWAITTRXDPARDTVLVENTPIDYLDFAS-PVSGLGSKXGLDATNK 458 Escherichia coli K-12
P72861 376 ALAFWSALpQFTYTKFVIVVDKSI-NIRDPRQVVWAISSKVDPVRDVFILPETPFDSLDFAS-EKIGLGGRMGIDATTK 452 Synechocystis sp. PCC ...
O30030 370 MYAIWGTG-MLSLTKIVVVVDDDV-NVHDMREVVWAVTSRFDPARDVVILPPSPTDSLDHSA-YIPNLAGKLGIDATKK 445 Archaeoglobus fulgidus...
O25157 377 MHAFWGVG-QMSFVKHAIFVNEDApNLRDTNAIIEYILENFS--KENALISQGVCDALDHAS-PEYAMGGKLGIDATSK 451 Helicobacter pylori 26695
P94405 365 GMRALTTPhGLGYCKMVIVVDEDV-DPFNLPQVMWALSTKMHPKHDAVIIPDLSVLPLDPGS-NPSGITHKMILDATTP 441 Bacillus subtilis subs...
P41655 336 IMAALAAH---PSLKHVVVVDEDI-DVLDPEEIEYAIATRVKGDDDILIVPGARGSSLDPAA-LPDGTTTKVGVDATAP 409 Methanothermobacter th...
Q58533 331 ILAAFASH---PSLKHVIVVDDDI-NIFDINDVEYAIATRVQGDKDIVIISGAKGSSLDPSSdLKNKLTAKVGVDATMS 405 Methanocaldococcus jan...
O28630 345 IIAALAAN---PSMKGVVVVDDDI-DILSYEDMEFAIATRFQPDRDLVVVKGARGSSLDPSA---DKTTSKWGIDATKP 416 Archaeoglobus fulgidus...
Q03034 386 VGDIYFRTkVGFIVHEIILVADDI-DIFNFKEVIWAYVTRHTPVADQMAFDDVTSFPLAPFVsQSSRSKTMKGGKCVTN 463 Saccharomyces cerevisi...
P26615 382 MMGVWSFLrQFMYTKFVIVCDDDV-NARDWNDVIWAITTRMDPARDTVLVENTPIDYLDFAS-PVSGLGSKMGLDATNK 458 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap