2BON


Conserved Protein Domain Family
TIGR00147

?
TIGR00147: TIGR00147 
Click on image for an interactive view with Cn3D
lipid kinase, YegS/Rv2252/BmrU family
The E. coli member of this family, YegS has been purified and shown to have phosphatidylglycerol kinase activity. The member from M. tuberculosis, Rv2252, has diacylglycerol kinase activity. BmrU from B. subtilis is in an operon with multidrug efflux transporter Bmr, but is uncharacterized. [Unknown function, Enzymes of unknown specificity]
Statistics
?
PSSM-Id: 161732
View PSSM: TIGR00147
Aligned: 5 rows
Threshold Bit Score: 449.647
Threshold Setting Gi: 489321923
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2BON_A        26 MAEFPASLLILNGKSTDNLPLREAIMLLREEGMTIHVRVTWEKg---DAARYVEEARKFGVATVIAGGGDGTINEVSTAL 102 Escherichia col...
P39074         3 HRKALLIHNGNAGNKNIEKALGAVVPVLSHHLDEVIIKQTKKK----DDAYHFCRSIDDSVDTVFILGGDGTIHQCINAI 78  Bacillus subtil...
WP_003233894   1 MKRARIIYNPTSGREIFKKHLAQVLQKFEQAGYETSTHATTCAg---DATHAAKEAALREFDLIIAAGGDGTINEVVNGL 77  Bacillales
WP_003229243   1 MSHWFFIINPTAGHRNGLRVWKSIQKELIKRKVEHRSFLTEHPghaeVLARQISTIQEYKLKRLIVIGGDGTMHEVVNGL 80  Bacillales
P76407         1 MAEFPASLLILNGKSTDNLPLREAIMLLREEGMTIHVRVTWEKg---DAARYVEEARKFGVATVIAGGGDGTINEVSTAL 77  Escherichia col...
2BON_A       103 IQCegDDIp--ALGILPLGTANDFATSVGIP-EALDKALKLAIAGDAIAIDMAQVNKQTc------FINMATGGF---GT 170 Escherichia col...
P39074        79 SAL--ERKp--AVGILPGGTCNDFSRVLGIP-QNLAKAAEALMAGKKTSVDVCQMNDRY-------FLNFWGIGL---IA 143 Bacillus subtil...
WP_003233894  78 APL--DNRp--TLGVIPVGTTNDFARALGIPrEDILKAADTVINGVARPIDIGQVNGQY-------FINIAGGGR---LT 143 Bacillales
WP_003229243  81 KDV--DDI---ELSFVPAGAYNDFSRGFSIKkIDLIQEIKKVKRPLTRTFHLGSVNFLQdksqilyFMNHIGIGFdayVN 155 Bacillales
P76407        78 IQC--EGDdipALGILPLGTANDFATSVGIP-EALDKALKLAIAGDAIAIDMAQVNKQTc------FINMATGGF---GT 145 Escherichia col...
2BON_A       171 RITTETPEK---LKAALGSVSYIIHGLMRMDTLQPDRCEIRGENFHWQGDALVIGIG-NGRQAGGGQQLCPNALINDGLL 246 Escherichia col...
P39074       144 ETSNQINET---EKALLGKISYFTSALRTVSSAASFPMTLKIDGEEIKEEAVMLLVM-NGQYIGTNRIPLPDASIEDGLL 219 Bacillus subtil...
WP_003233894 144 ELTYDVPSK---LKTMLGQLAYYLKGMEMLPSLRPTEVEIEYDGKLFQGEIMLFLVT-LTNSVGGFEKLAPDSSLNDGMF 219 Bacillales
WP_003229243 156 KKAMEFPLRrvfLFLRLRFLVYPLSHLHASATFKPFTLACTTEDETREFHDVWFAVVsNHPFYGGGMKAAPLANPREKTF 235 Bacillales
P76407       146 RITTETPEK---LKAALGSVSYIIHGLMRMDTLQPDRCEIRGENFHWQGDALVIGIG-NGRQAGGGQQLCPNALINDGLL 221 Escherichia col...
2BON_A       247 QLRIFTGDEILPALVSTLKSDE----DNPNIIEGASSWFDIQAPHDITFNLDGEPLSGQNFHIEILPAALRCRL 316 Escherichia coli BL21...
P39074       220 DVLICRNTNLTALRELMSMEQGsidrFTGELSYVQASRIEIETDTAKKADMDGEVYTHTPAVIQVLPQHIDMLV 293 Bacillus subtilis sub...
WP_003233894 220 DLMILKKANLAEFIRVATMALRgehiNDQHIIYTKANRVKVNVSEKMQLNLDGEYGGMLPGEFVNLYRHIHVVM 293 Bacillales
WP_003229243 236 DIVIVENQPFLKKYWLLCLMAFgkhtKMDGVTMFKAKDITFYTKDKIPFHADGEIMGTTPFRLASSPSPLRIKT 309 Bacillales
P76407       222 QLRIFTGDEILPALVSTLKSDE----DNPNIIEGASSWFDIQAPHDITFNLDGEPLSGQNFHIEILPAALRCRL 291 Escherichia coli K-12
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap