1CFZ


Conserved Protein Domain Family
hupD

?
TIGR00140: hupD 
Click on image for an interactive view with Cn3D
hydrogenase expression/formation protein
valid names: hupD, hynC, hoxM. C at 64 and 67 are believed to be metal binding. Postulated to be involved in processing or hydrogenase. Superfamily suggests that it is a peptidase/protease. [Protein fate, Protein modification and repair]
Statistics
?
PSSM-Id: 129246
View PSSM: TIGR00140
Aligned: 15 rows
Threshold Bit Score: 174.798
Threshold Setting Gi: 401579
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1CFZ_A        20 VRIVEALEQRYILPDYVEILDGGTAGMELLGDMANRDHLIIADAIVSKkNAPGTMMILRDEEVPALF-TNKISPHQLGLA 98  Escherichia coli
P19930        23 VRVAERLYAHYHWPEYVEIVDGGTQGLNLLGYVESASHLLILDAIDYG-LEPGTLRTYAGERIPAYLsAKKMSLHQNSFS 101 Escherichia col...
CAA79944      27 VRAVEEFHRRYAVPDNVTILDGGTQGLYLVNYLEEADRLIVFDAIDYG-LEPGRLKLVRDDEVPRFTgAKKMSLHQTGFQ 105 Bradyrhizobium ...
Q56362        24 VRAVEALQRHWVMSSNVQLLDGGTQGIYLVDRVRKADVLVVFDAVDYG-LPPGTMKRVEDDEVPRFLgAKKMSLHQTGFQ 102 Thiocapsa roseo...
P40591        23 VRCVELLNERYRFPDGVRLMDGGTQGIYLVQHVQQADCLIVFDAVDYG-LAPGTLKIVRDDEVPRFMgAKRMSLHQTGFQ 101 Azotobacter vin...
Q03004        26 VRCVERMAETHALPANVRLLDGGTQGLYLLPFLEEAEALIVFDAVDFG-FTPGTLVTMRDDDVPAFMgAKKMSLHQTGFQ 104 Rhodobacter cap...
P37182        20 VRIVEALEQRYILPDYVEILDGGTAGMELLGDMANRDHLIIADAIVSKkNAPGTMMILRDEEVPALF-TNKISPHQLGLA 98  Escherichia col...
CAA11501      25 VRLVEHLEARYDFSEQVTLFDGGTLGMRLMGPIMECDLLIVLDAVLGG-DEPGAMYRLTGDDLRKSL-AFKNSMHQTDLV 102 Desulfovibrio g...
WP_005996859  25 VRAVERLLETHDFSDNVTLMDGGNLGMKLMAPLMECDYCIVLDAVLGG-DAPGTIYRLTGEDLRKSL-AFKDSMHQSDLV 102 Desulfovibrio f...
WP_010880396  19 VRTVEELQRRYEFPENVKVLDGGTLGIDLLYHIEGTEKLLIIDAVLGG-KKPGTFYKIKNENVKKYF-KSKVSMHELGIQ 96  Aquifex aeolicus
1CFZ_A        99 DVLSALRFTGEFPkKLTLVGVIPESLEPHIG-LTPTVEAMIEPALEQVLAALRESG 153 Escherichia coli
P19930       102 EVLALADIRGHLPaHIALVGLQPAMLDDYGGsLSELAREQLPAAEQAALAQLAAWG 157 Escherichia coli K-12
CAA79944     106 EVISAADLLGRCPkHLVLIGCQPLDLEDWGGpLTPPVRDQIAPAIDLACQVLAEWG 161 Bradyrhizobium japonicum
Q56362       103 EVLALAAMLGDYPkHLLLIGVQPVELDDFGGsLRPQIKERITPAIEMALEYLAQFG 158 Thiocapsa roseopersicina
P40591       102 DVLALAAFSGAYPrELLLIGVQPEELEDFGGsLREPVRAQLEPALRVALEFLAERG 157 Azotobacter vinelandii
Q03004       105 DVIATAQLMGYCPsRMTLIGCQPVELEDYGGsLRPAVAGQIDFAIAEAVRELRAWG 160 Rhodobacter capsulatus
P37182        99 DVLSALRFTGEFPkKLTLVGVIPESLEPHIGlTP-TVEAMIEPALEQVLAALRESG 153 Escherichia coli K-12
CAA11501     103 DTLIFCQLAGHCP-EAVIIGMEPFDYETMHPeISPLAQERLPLMAEVALKEIAAHG 157 Desulfovibrio gigas
WP_005996859 103 DTLIYCELAGHRP-DTVVIGMEPLDFQNMSIeLSPAIAERVPAMIDIalaelaaag 157 Desulfovibrio fructosivorans
WP_010880396  97 EVLALLEVLEKPIkEIVVLGLEPKSLE-VSTeLTPEIQEKIPLLVEEALSQLKEWG 151 Aquifex aeolicus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap