Conserved Protein Domain Family
h_aconitase

?
TIGR00139: h_aconitase 
homoaconitase
Homoaconitase is known only as a fungal enzyme from two species, where it is part of an unusual lysine biosynthesis pathway. Because this model is based on just two sequences from a narrow taxonomic range, it may not recognize distant orthologs, should any exist. Homoaconitase, aconitase, and 3-isopropylmalate dehydratase have similar overall structures, but 3-isopropylmalate dehydratase is split into large (leuC) and small (leuD) chains in eubacteria. Several pairs of archaeal proteins resemble leuC and leuD over their lengths but are even closer to the respective domains of homoaconitase, and their identity is uncertain. [Amino acid biosynthesis, Aspartate family]
Statistics
?
PSSM-Id: 129245
View PSSM: TIGR00139
Aligned: 2 rows
Threshold Bit Score: 1351.63
Threshold Setting Gi: 1346476
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P49367    20 GQNLTEKIVQSYAVNLPEGKVVHSGDYVSIKPAHCMSHDNSWPVALKFMGLGATKIKNPSQIVTTLDHDIQNKSEKNLTK 99  Saccharomyces cerev...
CAA67943  65 PQTLTEKIVQKYSVGLPQGKFVKSGDYVTIQPHRCMTHDNSWPCALKFMSIGASRLHNPDQIVMTLDHDVQNKSDKNLKK 144 Aspergillus nidulans
P49367   100 YKNIENFAKKHHIDHYPAGRGIGHQIMIEEGYAFPLNMTVASDSHSNTYGGLGSLGTPIVRTDAAAIWATGQTWWQIPPV 179 Saccharomyces cerev...
CAA67943 145 YRQIEEFATQHGVEFYPAGRGIGHQIMIEEGFAWPGTLAVASDSHSNMYGGVGCLGTPIVRTDAASVWATGKTWWQIPPV 224 Aspergillus nidulans
P49367   180 AQVELKGQLPQGVSGKDIIVALCGLFNNDQVLNHAIEFTG--DSLNALPIDHRLTIANMTTEWGALSGLFPVDKTLIDWY 257 Saccharomyces cerev...
CAA67943 225 AKVTFKGVLPPGVTGKDVIVALCGLFNKDDVLNHAIEFTGseETMRSLSVDTRLTIANMTTEWGALSGLFPIDSVLKGWL 304 Aspergillus nidulans
P49367   258 KNR--LQKLGTNNHPRINPKTIR----ALEEKAKIP-KADKDAHYAKKLIIDLATLTHYVSGPNSVKVSNTVQDLSQQDI 330 Saccharomyces cerev...
CAA67943 305 RGKatTAAMGLADGPFKTRAAERfthpLLEQLFENPlTADKGAKYAKELFLDLSSLSPYVSGPNSVKVATPLKELEAQNI 384 Aspergillus nidulans
P49367   331 KINKAYLVSCTNSRLSDLQSAADVVCPTGDLN--KVNKVApGVEFYVAAASSEIEADARKSGAWEKLLKAGCIPLPSGCG 408 Saccharomyces cerev...
CAA67943 385 KVDKAYLVSCTNSRASDIAAAAKVFKEAAEKNggKIPKIH-GVKFYIAAASIPEQLAAEGNGDWQTLLEAGATQLPAGCG 463 Aspergillus nidulans
P49367   409 PCIGLGAGLLEPGEVGISATNRNFKGRMGSKDALAYLASPAVVAASAVLGKISSPAEVLSTS---EIPFS---GVKTE-- 480 Saccharomyces cerev...
CAA67943 464 PCIGMGQGLLEPGEVGISASNRNFKGRMGSTEAKAYLGSPEVVAASALSGKLSGPGWYQTPEgwtEVIRGegdGIREEdr 543 Aspergillus nidulans
P49367   481 -------------IIENPVVEEEVNAQTEAPKQS------VEILEGFPREFSGELVLCDADNINTDGIYPGKYTYQDDVP 541 Saccharomyces cerev...
CAA67943 544 mltneealekiigQLDDLVADGEKRFASETPAVEeseqglTEIYPGFPERVSGELVFCDADNVNTDGIYPGKYTYQDDVP 623 Aspergillus nidulans
P49367   542 KEKMAQVCMENYDAEFRTKVHPGDIVVSGFNFGTGSSREQAATALLAKGINLVVSGSFGNIFSRNSINNALLTLEIPALI 621 Saccharomyces cerev...
CAA67943 624 PETMARVCMENYDPEFSTTAKEGDILVSGFNFGCGSSREQAATAILAKKIPLVVSGSFGNIFSRNSINNALMGLEVPRLV 703 Aspergillus nidulans
P49367   622 KKLREKYQGAPKELTRRTGWFLKWDVADAKVVVTEGslDGPVILEQKVGELGKNLQEIIVKGGLEGWVKSQL 693 Saccharomyces cerevisiae S288c
CAA67943 704 NRLRETFGSGDKVLTRRTGWTLTWDVRKSQIEVQEG--PGGPKWTHKVGELPPNVQEIIAKGGLEKWVKNAI 773 Aspergillus nidulans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap