Conserved Protein Domain Family
gid_trmFO

?
TIGR00137: gid_trmFO 
tRNA:m(5)U-54 methyltransferase
This model represents an orthologous set of proteins present in relatively few bacteria but very tightly conserved where it occurs. It is closely related to gidA (glucose-inhibited division protein A), which appears to be present in all complete eubacterial genomes so far and in Saccharomyces cerevisiae. It was designated gid but is now recognized as a tRNA:m(5)U-54 methyltransferase and is now designated trmFO. [Protein synthesis, tRNA and rRNA base modification]
Statistics
?
PSSM-Id: 129243
View PSSM: TIGR00137
Aligned: 3 rows
Threshold Bit Score: 761.753
Threshold Setting Gi: 26006757
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q55692   5 TPIHVIGGGLAGTEAAWQIAQAGVPVILTEMRPERLSPAHHSEDLAELVCSNSFGAKAGDRAAGLLQTELRQLSSLIITT 84  Synechocystis sp. PCC...
P39815   4 QTVNVIGAGLAGSEAAWQLAKRGIQVKLYEMRPVKQTPAHHTDKFAELVCSNSLRSNTLANAVGVLKEEMRALDSAIIAA 83  Bacillus subtilis sub...
O66913   3 EKVIVIGGGLAGSEAAWRLANEGHRVILYEMRPKKMTPAHKTGNLAELVCSNTLGGLELTTGAGLLKAEMQKLGSLVIEA 82  Aquifex aeolicus VF5
Q55692  85 ADRHAVPAGGALAVDRGIFSRSLTEQVASHPLVELRRGEVTEIPREgITVLTTGPLTSPALTEDLQQFTGMEYLSFFDAA 164 Synechocystis sp. PCC...
P39815  84 ADECSVPAGGALAVDRHEFAASVTNRVKNHPNVTVINEEVTEIPEG-PTIIATGPLTSESLSAQLKELTGEDYLYFYDAA 162 Bacillus subtilis sub...
O66913  83 AKVARVPAGGALGVDRKIFSEYITEKIESHPNITLIREEVKEIPEDeVVVIATGPLTSDALSEKIKELVGYDTLYFYDAI 162 Aquifex aeolicus VF5
Q55692 165 SPIVVGDSINKEVAFFASRYDKGEAAYLNCPFNREQYFNFWQALCEAEQAPLKDFdrETAKFFEGCLPIEELAQRGEDTM 244 Synechocystis sp. PCC...
P39815 163 APIVEKDSLDMDKVYLKSRYDKGEAAYLNCPMTEEEFDRFHEALTSAETVPLKEF--EKEIFFEGCMPIEVMAKRGKKTM 240 Bacillus subtilis sub...
O66913 163 APIVEAESVDFSKGFWGSRYGKGGDDYFNCVLTEEEYKKFYEELLKAEKVKPKDF--EKAVHFEGCLPIEEMAERGYKTL 240 Aquifex aeolicus VF5
Q55692 245 RYGPLKPVGLFDARLGdfrdpankeKKPYAVVQLRQEDKAGQLWNMVGFQTNLRWGEQGRVFRLIPGLENAEFVRMGVMH 324 Synechocystis sp. PCC...
P39815 241 LFGPMKPVGLEHPVTG---------KRPYAVVQLRQDDAAGTLYNIVGFQTHLKWGDQKEVLKLIPGLENVEIVRYGVMH 311 Bacillus subtilis sub...
O66913 241 LFGPMKPVGLVDPRTG---------KEPFAVVQLRKENKEGTLLSLVGFQTKLTYKEQKRVFRLIPCLRNAVFVRLGSMH 311 Aquifex aeolicus VF5
Q55692 325 RNTFINSPQLLTASLHFGDRQTLFAAGQLVGTEGYAAATAGGWLAGTNAARLALGLPLLTLPATTMMGALFNFISSASPK 404 Synechocystis sp. PCC...
P39815 312 RNTFINSPSLLKPTYQFKNRSDLFFAGQMTGVEGYVESAASGLVAGINAAKLVLGEELVIFPQETAIGSMAHYITTTNQK 391 Bacillus subtilis sub...
O66913 312 RNTFIQSNKVLTHYLNLKKKENIFFAGQITGVEGYVASSATGILAGINAGRLARGEKPLKAPTETMLGALVNYIVTK-EG 390 Aquifex aeolicus VF5
Q55692 405 HFQPMPPNFGILPELPQRIRNKQERYGQYRDRALADLTTWQTSI 448 Synechocystis sp. PCC 6803 substr. Kazusa
P39815 392 NFQPMNANFGLLKELPVKIKNKKERNEQYANRAIETIQTISKTI 435 Bacillus subtilis subsp. subtilis str. 168
O66913 391 ELQPMNPVFGLLPPLEKKVRDKKKRKELMAKRALETMEKWIKEN 434 Aquifex aeolicus VF5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap