2QFV,2CMJ


Conserved Protein Domain Family
nadp_idh_euk

?
TIGR00127: nadp_idh_euk 
Click on image for an interactive view with Cn3D
isocitrate dehydrogenase, NADP-dependent, eukaryotic type
This model describes a eukaryotic, NADP-dependent form of isocitrate dehydrogenase. These eukaryotic enzymes differ considerably from a fairly tight cluster that includes all other related isocitrate dehydrogenases, 3-isopropylmalate dehydrogenases, and tartrate dehydrogenases. Several NAD- or NADP-dependent dehydrogenases, including 3-isopropylmalate dehydrogenase, tartrate dehydrogenase, and the multimeric forms of isocitrate dehydrogenase, share a nucleotide binding domain unrelated to that of lactate dehydrogenase and its homologs. These enzymes dehydrogenate their substates at a H-C-OH site adjacent to a H-C-COOH site; the latter carbon, now adjacent to a carbonyl group, readily decarboxylates. This model does not discriminate cytosolic, mitochondrial, and chloroplast proteins. However, the model starts very near the amino end of the cytosolic form; the finding of additional amino-terminal sequence may indicate a transit peptide. [Energy metabolism, TCA cycle]
Statistics
?
PSSM-Id: 129233
View PSSM: TIGR00127
Aligned: 6 rows
Threshold Bit Score: 788.299
Threshold Setting Gi: 149241012
Created: 7-Oct-2014
Updated: 2-Oct-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QFV_A  17 SKIKVKQPVVELDGDEMTRIIWDKIKKKLILPYLDVDLKYYDLSVESRDATSDKITQDAAEAIKKYGVGIKCATITPDEA 96  baker's yeast
P41939   2 TKIKVANPIVEMDGDEQTRIIWHLIRDKLVLPYLDVDLKYYDLSVEYRDQTNDQVTVDSATATLKYGVAVKCATITPDEA 81  Saccharomyces cerevis...
P21954  18 SKIKVKQPVVELDGDEMTRIIWDKIKKKLILPYLDVDLKYYDLSVESRDATSDKITQDAAEAIKKYGVGIKCATITPDEA 97  Saccharomyces cerevis...
P41562   3 RKIHGGS-VVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEK 81  Norway rat
Q40345  25 QKIKVANPIVEMDGDEMTRIIWKYIKDKLIFPFVELDIKYFDLGLPYRDETNDKVTVESAEATLKYNVAIKCATITPDEA 104 Medicago sativa
2CMJ_A   1 -KIQGGS-VVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEK 78  house mouse
2QFV_A  97 RVKEFNLHKMWKSPNGTIRNILGGTVFREPIVIPRIPRLVPRWEKPIIIGRHAHGDQYKATDTLIPGPGSLELVYKPSdp 176 baker's yeast
P41939  82 RVEEFHLKKMWKSPNGTIRNILGGTVFREPIIIPRIPRLVPQWEKPIIIGRHAFGDQYKATDVIVPEEGELRLVYKSKs- 160 Saccharomyces cerevis...
P21954  98 RVKEFNLHKMWKSPNGTIRNILGGTVFREPIVIPRIPRLVPRWEKPIIIGRHAHGDQYKATDTLIPGPGSLELVYKPSdp 177 Saccharomyces cerevis...
P41562  82 RVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVTGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPKd- 160 Norway rat
Q40345 105 RVKEFGLKSMWRSPNGTIRNILNGTVFREPIICKNIPRLIPGWTKPICIGRHAFGDQYRATDSVIKGPGKLKLVFVPEg- 183 Medicago sativa
2CMJ_A  79 RVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVTGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPKd- 157 house mouse
2QFV_A 177 tTAQPQTLKVYDYKGSG-VAMAMYNTDESIEGFAHSSFKLAIDKKLNLFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKF 255 baker's yeast
P41939 161 -GTHDVDLKVFDYPEHGgVAMMMYNTTDSIEGFAKASFELAIERKLPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKF 239 Saccharomyces cerevis...
P21954 178 tTAQPQTLKVYDYKGSG-VAMAMYNTDESIEGFAHSSFKLAIDKKLNLFLSTKNTILKKYDGRFKDIFQEVYEAQYKSKF 256 Saccharomyces cerevis...
P41562 161 -GSQKVTYLVHDFEEGGgVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSKF 239 Norway rat
Q40345 184 -QGETTDLEVYNFTGEGgVALAMYNTDESIRSFAEASMAVALEKKWPLYLSTKNTILKKYDGRFKDIFQEVYEAGWKSKY 262 Medicago sativa
2CMJ_A 158 -GTQKVTYMVHDFEEGGgVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKKYKSQF 236 house mouse
2QFV_A 256 EQLGIHYEHRLIDDMVAQMIKSKGGFIMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRKY 335 baker's yeast
P41939 240 ESLGIWYEHRLIDDMVAQMLKSKGGYIIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGTVTRHFRQH 319 Saccharomyces cerevis...
P21954 257 EQLGIHYEHRLIDDMVAQMIKSKGGFIMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRKY 336 Saccharomyces cerevis...
P41562 240 EAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDGKTVEAEAAHGTVTRHYRMY 319 Norway rat
Q40345 263 EAAGIWYEHRLIDDMVAYALKSEGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHFRVH 342 Medicago sativa
2CMJ_A 237 EAQNICYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLICPDGKTVEAEAAHGTVTRHYRMY 316 house mouse
2QFV_A 336 QKGEETSTNSIASIFAWSRGLLKRGELDNTPALCKFANILESATLNTVQQdGIMTKDLALACGNN---ERSAYVTTEEFL 412 baker's yeast
P41939 320 QQGKETSTNSIASIFAWTRGIIQRGKLDNTPDVVKFGQILESATVNTVQEdGIMTKDLALILGKS---ERSAYVTTEEFI 396 Saccharomyces cerevis...
P21954 337 QKGEETSTNSIASIFAWSRGLLKRGELDNTPALCKFANILESATLNTVQQdGIMTKDLALACGNN---ERSAYVTTEEFL 413 Saccharomyces cerevis...
P41562 320 QKGQETSTNPIASIFAWSRGLAHRAKLDNNTELSFFANALEEVCIETIEA-GFMTKDLAACIKGLpnvQRSDYLNTFEFM 398 Norway rat
Q40345 343 QKGGETSTNSIASIFAWTRGLAHRAKLDDNATLLDFTEKLEAACIGVVES-GKMTKDLALILHGSk-lSREHYLNTEEFI 420 Medicago sativa
2CMJ_A 317 QKGQETSTNPIASIFAWSRGLAHRAKLDNNTELSFFAKALEDVCIETIEA-GFMTKDLAACIKGLpnvQRSDYLNTFEFM 395 house mouse
2QFV_A 413 DAVEKRLQKEIKS 425 baker's yeast
P41939 397 DAVESRLKKEFEA 409 Saccharomyces cerevisiae S288c
P21954 414 DAVEKRLQKEIKS 426 Saccharomyces cerevisiae S288c
P41562 399 DKLGENLKAKLAQ 411 Norway rat
Q40345 421 DAVAAELKTKISA 433 Medicago sativa
2CMJ_A 396 DKLGENLKAKLAQ 408 house mouse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap